• Gene id: 5723

Gene Summary

• Gene Symbol: PSPH   Gene   UCSC   Ensembl
• Aliases: PSP, PSPHD
• Gene name: phosphoserine phosphatase
• Alternate names: phosphoserine phosphatase, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, PSPase,
• Gene location: 7p11.2 (56051603: 56010486)     Exons: 12     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i
• OMIM: 172480

Protein Summary

• Protein general information: P78330  
  • Name: Phosphoserine phosphatase (PSP) (PSPase) (EC 3.1.3.3) (L 3 phosphoserine phosphatase) (O phosphoserine phosphohydrolase)
  • Length: 225  
  • Mass: 25008
• Sequence:

  MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQ
  VQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQ
  PTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

• Structural information:
  • Interpro: IPR036412  IPR023214  IPR023190  
  • PDB: 1L8L 1L8O 1NNL 6HYY 6Q6J
  • PDBsum: 1L8L 1L8O 1NNL 6HYY 6Q6J
  • STRING: ENSP00000378854
• Other Databases: GeneCards:  PSPH  Malacards:  PSPH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016311	dephosphorylation	IBA	biological process
GO:0004647	phosphoserine phosphatase activity	IBA	molecular function
GO:0000287	magnesium ion binding	IBA	molecular function
GO:0016791	phosphatase activity	IBA	molecular function
GO:0006564	L-serine biosynthetic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004647	phosphoserine phosphatase activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006563	L-serine metabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0004647	phosphoserine phosphatase activity	IEA	molecular function
GO:0006564	L-serine biosynthetic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006564	L-serine biosynthetic process	IEA	biological process
GO:0006563	L-serine metabolic process	TAS	biological process
GO:0004647	phosphoserine phosphatase activity	IEA	molecular function
GO:0006564	L-serine biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0004647	phosphoserine phosphatase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00260	Glycine, serine and threonine metabolism

Diseases

Associated diseases	References
Phosphoserine phosphatase deficiency	KEGG:H02116
Phosphoserine phosphatase deficiency	KEGG:H02116
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R