• Gene id: 57222

Gene Summary

• Gene Symbol: ERGIC1   Gene   UCSC   Ensembl
• Aliases: AMCN, ERGIC-32, ERGIC32, NET24
• Gene name: endoplasmic reticulum-golgi intermediate compartment 1
• Alternate names: endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1, endoplasmic reticulum-golgi intermediate compartment 32 kDa protein,
• Gene location: 5q35.1 (172834250: 172952682)     Exons: 14     NC_000005.10
• Gene summary(Entrez): This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeq, Jul 2008]
• OMIM: 601309

Protein Summary

• Protein general information: Q969X5  
  • Name: Endoplasmic reticulum Golgi intermediate compartment protein 1 (ER Golgi intermediate compartment 32 kDa protein) (ERGIC 32)
  • Length: 290  
  • Mass: 32592
• Sequence:

  MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKIDVSLNI
  SLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVI
  HKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRI
  IPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH

• Structural information:
  • Interpro: IPR012936  IPR039542  
  • STRING: ENSP00000377374
• Other Databases: GeneCards:  ERGIC1  Malacards:  ERGIC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Neurogenic arthrogryposis multiplex congenita	KEGG:H02299
Neurogenic arthrogryposis multiplex congenita	KEGG:H02299
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq