• Gene id: 57214

Gene Summary

• Gene Symbol: CEMIP   Gene   UCSC   Ensembl
• Aliases: CCSP1, HYBID, KIAA1199, TMEM2L
• Gene name: cell migration inducing hyaluronidase 1
• Alternate names: cell migration-inducing and hyaluronan-binding protein, cell migration inducing hyaluronan binding protein, cell migration inducing protein, hyaluronan binding, colon cancer secreted protein 1, hyaluronan-binding protein involved in hyaluronan depolymerizatio,
• Gene location: 15q25.1 (39622954: 39708123)     Exons: 8     NC_000007.14
• OMIM: 608366

Protein Summary

• Protein general information: Q8WUJ3  
  • Name: Cell migration inducing and hyaluronan binding protein (EC 3.2.1.35)
  • Length: 1361  
  • Mass: 152998
  • Tissue specificity: Expressed in dermal and in synovial fibroblasts. Strongly expressed in gastric cancers compared with the paired normal tissues. Strongly expressed in both ductal carcinoma and invasive breast cancer cells compared with benign epithelia
• Sequence:

  MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSI
  HISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGA
  LELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNA
  VPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVF
  KLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEV
  VYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVNSTILNLEDNVQSWKPGDTLVIASTDYSMYQ
  AEEFQVLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAEVGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFG
  GHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFHLAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLI
  KDVVGYNSLGHCFFTEDGPEERNTFDHCLGLLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQDCNAVSTFWM
  ANPNNNLINCAAAGSEETGFWFIFHHVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRAGMIIDNGVKTTEASA
  KDKRPFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPY
  DDGSKQEIKNSLFVGESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEG
  RHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTK
  NDNWLVRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIKNDFPSHPLYLEGALTRSTHYQQYQPVVTLQ
  KGYTIHWDQTAPAELAIWLINFNKGDWIRVGLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVEQSYPG
  RSHYYWDEDSGLLFLKLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAVVDVPMPKKLF
  GSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVVVIDGNQGRVVSHTSFRNSILQGIPWQ
  LFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKEQMAFVGFKGSFRPIWVTLDTEDHKAKIFQV
  VPIPVVKKKKL

• Structural information:
  • Protein Domains: (44..16-)
    (/note="G8-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00817"-)
  • Interpro: IPR019316  IPR039477  IPR011050  IPR039473  IPR025155  
  • Prosite: PS51484
  • CDD: cd13938
  • STRING: ENSP00000378177
• Other Databases: GeneCards:  CEMIP  Malacards:  CEMIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046923	ER retention sequence binding	IDA	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:1900020	positive regulation of protein kinase C activity	IDA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0004415	hyalurononglucosaminidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0030213	hyaluronan biosynthetic process	TAS	biological process
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0030214	hyaluronan catabolic process	IEA	biological process
GO:0030665	clathrin-coated vesicle membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032050	clathrin heavy chain binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0045334	clathrin-coated endocytic vesicle	IDA	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0007605	sensory perception of sound	IMP	biological process
GO:0030214	hyaluronan catabolic process	IMP	biological process
GO:0004415	hyalurononglucosaminidase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R