• Gene id: 572

Gene Summary

• Gene Symbol: BAD   Gene   UCSC   Ensembl
• Aliases: BBC2, BCL2L8
• Gene name: BCL2 associated agonist of cell death
• Alternate names: bcl2-associated agonist of cell death, BCL-X/BCL-2 binding protein, BCL2-antagonist of cell death protein, BCL2-binding component 6, BCL2-binding protein, bcl-2-binding component 6, bcl-2-like protein 8, bcl-XL/Bcl-2-associated death promoter, bcl2 antago,
• Gene location: 11q13.1 (64284703: 64269827)     Exons: 3     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their
• OMIM: 603167

SNPs

rs10246939

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.141972804T>C
NC_000007.13   g.141672604T>C
NG_016141.1   g.5970A>G
NM_176817.5   c.886A>G
NM_176817.4   c.886A>G
NW_003571040.1   g.114755T>C
NP_789787.5   p.Ile296Val|SEQ=[T/C]|GENE=TAS2R38

Protein Summary

• Protein general information: Q92934  
  • Name: Bcl2 associated agonist of cell death (BAD) (Bcl 2 binding component 6) (Bcl 2 like protein 8) (Bcl2 L 8) (Bcl xL/Bcl 2 associated death promoter) (Bcl2 antagonist of cell death)
  • Length: 168  
  • Mass: 18,392
• Sequence:

  MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSS
  YPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
  FQSWWDRNLGRGSSAPSQ

• Structural information:
  • Interpro: IPR018868  
  • PDB: 1G5J
  • PDBsum: 1G5J
  • DIP: 29184
  • STRING: ENSP00000309103
• Other Databases: GeneCards:  BAD  Malacards:  BAD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001836	release of cytochrome c from mitochondria	IEA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IMP	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006007	glucose catabolic process	IEA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0009749	response to glucose	IEA	biological process
GO:0010508	positive regulation of autophagy	TAS	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	ISS	biological process
GO:0019050	suppression by virus of host apoptotic process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0021987	cerebral cortex development	IEA	biological process
GO:0030346	protein phosphatase 2B binding	IEA	molecular function
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0033133	positive regulation of glucokinase activity	ISS	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0034201	response to oleic acid	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043422	protein kinase B binding	IEA	molecular function
GO:0044342	type B pancreatic cell proliferation	ISS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0045918	negative regulation of cytolysis	IMP	biological process
GO:0046031	ADP metabolic process	ISS	biological process
GO:0046034	ATP metabolic process	ISS	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IMP	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IMP	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0060139	positive regulation of apoptotic process by virus	IEA	biological process
GO:0060154	cellular process regulating host cell cycle in response to virus	IEA	biological process
GO:0071247	cellular response to chromate	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071316	cellular response to nicotine	IDA	biological process
GO:0071396	cellular response to lipid	IEA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IMP	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:2000078	positive regulation of type B pancreatic cell development	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IEA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IMP	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006007	glucose catabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IEA	molecular function
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0009725	response to hormone	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0010508	positive regulation of autophagy	TAS	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	IEA	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	ISS	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019050	suppression by virus of host apoptotic process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0021987	cerebral cortex development	IEA	biological process
GO:0030346	protein phosphatase 2B binding	IEA	molecular function
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0033133	positive regulation of glucokinase activity	IEA	biological process
GO:0033133	positive regulation of glucokinase activity	ISS	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0034201	response to oleic acid	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043422	protein kinase B binding	IEA	molecular function
GO:0044342	type B pancreatic cell proliferation	IEA	biological process
GO:0044342	type B pancreatic cell proliferation	ISS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0045918	negative regulation of cytolysis	IMP	biological process
GO:0046031	ADP metabolic process	IEA	biological process
GO:0046031	ADP metabolic process	ISS	biological process
GO:0046034	ATP metabolic process	IEA	biological process
GO:0046034	ATP metabolic process	ISS	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IMP	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IMP	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0060139	positive regulation of apoptotic process by virus	IEA	biological process
GO:0060154	cellular process regulating host cell cycle in response to virus	IEA	biological process
GO:0071247	cellular response to chromate	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071316	cellular response to nicotine	IDA	biological process
GO:0071396	cellular response to lipid	IEA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IMP	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:2000078	positive regulation of type B pancreatic cell development	IEA	biological process
GO:2000078	positive regulation of type B pancreatic cell development	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IMP	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0010508	positive regulation of autophagy	TAS	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0033133	positive regulation of glucokinase activity	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0044342	type B pancreatic cell proliferation	ISS	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0045918	negative regulation of cytolysis	IMP	biological process
GO:0046031	ADP metabolic process	ISS	biological process
GO:0046034	ATP metabolic process	ISS	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IMP	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0046931	pore complex assembly	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IMP	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071316	cellular response to nicotine	IDA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IMP	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:2000078	positive regulation of type B pancreatic cell development	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04140	Autophagy - animal
hsa04210	Apoptosis
hsa04510	Focal adhesion
hsa04062	Chemokine signaling pathway
hsa04910	Insulin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa05200	Pathways in cancer
hsa05203	Viral carcinogenesis
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05221	Acute myeloid leukemia
hsa05220	Chronic myeloid leukemia
hsa05218	Melanoma
hsa05211	Renal cell carcinoma
hsa05215	Prostate cancer
hsa05213	Endometrial cancer
hsa05223	Non-small cell lung cancer
hsa05010	Alzheimer disease
hsa05014	Amyotrophic lateral sclerosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01524	Platinum drug resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer	GAD: 19730683
Cancer (thyroid)	GAD: 19730683
Cancer (lymphoma)	GAD: 18636124
Parkinson disease	GAD: 18568448
Polycystic ovary syndrome (PCOS)	INFBASE: 17008325
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Male factor infertility	MIK: 26209830
Female infertility	INFBASE: 17008325
Semen quality, Sperm motility	MIK: 26209830
Sperm motility	MIK: 26209830
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26209830	Semen quality, Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)