• Gene id: 57181

Gene Summary

• Gene Symbol: SLC39A10   Gene   UCSC   Ensembl
• Aliases: LZT-Hs2
• Gene name: solute carrier family 39 member 10
• Alternate names: zinc transporter ZIP10, ZIP-10, solute carrier family 39 (metal ion transporter), member 10, solute carrier family 39 (zinc transporter), member 10, zrt- and Irt-like protein 10,
• Gene location: 2q32.3 (195575943: 195737700)     Exons: 17     NC_000002.12
• Gene summary(Entrez): Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily
• OMIM: 608733

Protein Summary

• Protein general information: Q9ULF5  
  • Name: Zinc transporter ZIP10 (Solute carrier family 39 member 10) (Zrt and Irt like protein 10) (ZIP 10)
  • Length: 831  
  • Mass: 94132
• Sequence:

  MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENG
  RLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTKRN
  HKCDPEKETVEVSVKSDDKHMHDHNHRLRHHHRLHHHLDHNNTHHFHNDSITPSERGEPSNEPSTETNKTQEQSD
  VKLPKGKRKKKGRKSNENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHVHLPERNGHDPGRGHQDLDPD
  NEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHGANSPISTDLFTYLCPALLYQIDSRL
  CIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGT
  MSGDALLHLLPHSQGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR
  GKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIE
  EEKIIDHSHSDGLHTIHEHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHHSHGPCHSGSDLKETGIANIAWMVIM
  GDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGT
  AVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKI
  VFDIQF

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000386766
• Other Databases: GeneCards:  SLC39A10  Malacards:  SLC39A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0050861	positive regulation of B cell receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0071578	zinc ion import across plasma membrane	IEA	biological process
GO:0002903	negative regulation of B cell apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IEA	biological process
GO:1903615	positive regulation of protein tyrosine phosphatase activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq