• Gene id: 57180

Gene Summary

• Gene Symbol: ACTR3B   Gene   UCSC   Ensembl
• Aliases: ARP11, ARP3BETA
• Gene name: actin related protein 3B
• Alternate names: actin-related protein 3B, ARP3 actin related protein 3 homolog B, ARP3-beta, actin-like protein 3B, actin-related protein 3-beta, actin-related protein ARP4, actin-related protein Arp11,
• Gene location: 7q36.1-q36.2 (152759748: 153070978)     Exons: 22     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the actin-related proteins (ARP), which form multiprotein complexes and share 35-55% amino acid identity with conventional actin. The protein encoded by this gene may have a regulatory role in the actin cytoskeleton and induc

Protein Summary

• Protein general information: Q9P1U1  
  • Name: Actin related protein 3B (ARP3 beta) (Actin like protein 3B) (Actin related protein ARP4)
  • Length: 418  
  • Mass: 47608
  • Tissue specificity: Detected in fetal brain. Detected throughout the adult brain, in neurons from gray matter, but not in white matter. Detected in liver, skeletal muscle and pancreas. Detected in lung adenocarcinoma cells with low metastatic potential, b
• Sequence:

  MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPTYATK
  WPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALA
  ASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAK
  AIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
  DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRY
  AVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR015623  
  • Prosite: PS01132
  • STRING: ENSP00000256001
• Other Databases: GeneCards:  ACTR3B  Malacards:  ACTR3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	contributes to
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq