• Gene id: 57179

Gene Summary

• Gene Symbol: KIAA1191   Gene   UCSC   Ensembl
• Aliases: p33MONOX, p60MONOX
• Gene name: KIAA1191
• Alternate names: putative monooxygenase p33MONOX, brain-derived rescue factor p60MONOX, flavin monooxygenase motif-containing protein of 33 kDa, flavine monooxygenase motif-containing protein of 33 kDa, p60MONOX brain-derived rescue factor,
• Gene location: 5q35.2 (176361864: 176346060)     Exons: 9     NC_000005.10

Protein Summary

• Protein general information: Q96A73  
  • Name: Putative monooxygenase p33MONOX (EC 1. . . ) (Brain derived rescue factor p60MONOX) (Flavin monooxygenase motif containing protein of 33 kDa)
  • Length: 305  
  • Mass: 33247
  • Tissue specificity: Down-regulated in the occipital lobe of an early stage Alzheimer disease patients. {ECO
• Sequence:

  MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEA
  SLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAE
  ALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSL
  FGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVL
  TPTGF

• Structural information:
  • Interpro: IPR026759  
  • STRING: ENSP00000298569
• Other Databases: GeneCards:  KIAA1191  Malacards:  KIAA1191

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)