Search Result
Gene id | 57179 | ||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | KIAA1191 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | p33MONOX, p60MONOX | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | KIAA1191 | ||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | putative monooxygenase p33MONOX, brain-derived rescue factor p60MONOX, flavin monooxygenase motif-containing protein of 33 kDa, flavine monooxygenase motif-containing protein of 33 kDa, p60MONOX brain-derived rescue factor, | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
5q35.2 (176361864: 176346060) Exons: 9 NC_000005.10 |
||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q96A73 Name: Putative monooxygenase p33MONOX (EC 1. . . ) (Brain derived rescue factor p60MONOX) (Flavin monooxygenase motif containing protein of 33 kDa) Length: 305 Mass: 33247 Tissue specificity: Down-regulated in the occipital lobe of an early stage Alzheimer disease patients. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEA SLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAE ALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSL FGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVL TPTGF | ||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: KIAA1191 Malacards: KIAA1191 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
|