• Gene id: 57178

Gene Summary

• Gene Symbol: ZMIZ1   Gene   UCSC   Ensembl
• Aliases: MIZ, NEDDFSA, RAI17, TRAFIP10, ZIMP10
• Gene name: zinc finger MIZ-type containing 1
• Alternate names: zinc finger MIZ domain-containing protein 1, retinoic acid induced 17, zinc finger-containing, Miz1, PIAS-like protein on chromosome 10,
• Gene location: 10q22.3 (103629187: 103701550)     Exons: 18     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the PIAS (protein inhibitor of activated STAT) family of proteins. The encoded protein regulates the activity of various transcription factors, including the androgen receptor, Smad3/4, and p53. The encoded protein may also p
• OMIM: 607159

Protein Summary

• Protein general information: Q9ULJ6  
  • Name: Zinc finger MIZ domain containing protein 1 (PIAS like protein Zimp10) (Retinoic acid induced protein 17)
  • Length: 1067  
  • Mass: 115483
  • Tissue specificity: Expressed most abundantly in ovary and, at lower levels, in prostate, spleen and testis. Weak expression, if any, in thymus, small intestine, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGY
  RLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPPGKLPMQPPLSSMSSMKPTLSHSDGSFPYDS
  VPWQQNTNQPPGSLSVVTTVWGVTNTSQSQVLGNPMANANNPMNPGGNPMASGMTTSNPGLNSPQFAGQQQQFSA
  KAGPAQPYIQQSMYGRPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPAAAAAAAAVAAAAATATATAT
  ATVAALQETQNKDINQYGPMGPTQAYNSQFMNQPGPRGPASMGGSMNPASMAAGMTPSGMSGPPMGMNQPRPPGI
  SPFGTHGQRMPQQTYPGPRPQSLPIQNIKRPYPGEPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRM
  PSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSS
  IPPYLSPSQDVKPPFPPDIKPNMSALPPPPANHNDELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTL
  MWRSDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLTIERGDNKTSHKPLHLKHVCQPGRNTIQITVTACCCSH
  LFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSVAASSGNTTLNGEDGVEQTAIKVSLKCPITFRRIQ
  LPARGHDCKHVQCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMWGILNAIQHSEFEEVTIDPTCSWRPV
  PIKSDLHIKDDPDGIPSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTNSNDYSSQGNNYQGHGNFD
  FPHGNPGGTSMNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQQGLHVPHPSSQSGPP
  LHHSGAPPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGAQGASDMPEPSLDLLPELTNPDELLSYLDPP
  DLPSNSNDDLLSLFENN

• Structural information:
  • Interpro: IPR040797  IPR004181  IPR013083  
  • Prosite: PS51044
  • PDB: 5AIZ
  • PDBsum: 5AIZ
  • STRING: ENSP00000334474
• Other Databases: GeneCards:  ZMIZ1  Malacards:  ZMIZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0048096	chromatin-mediated maintenance of transcription	IBA	biological process
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016925	protein sumoylation	IBA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030521	androgen receptor signaling pathway	IDA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IDA	biological process
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0033233	regulation of protein sumoylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0045582	positive regulation of T cell differentiation	ISS	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0046332	SMAD binding	IPI	molecular function
GO:0021852	pyramidal neuron migration	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0048844	artery morphogenesis	IEA	biological process
GO:0048589	developmental growth	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007296	vitellogenesis	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray