• Gene id: 57175

Gene Summary

• Gene Symbol: CORO1B   Gene   UCSC   Ensembl
• Aliases: CORONIN-2
• Gene name: coronin 1B
• Alternate names: coronin-1B, coronin, actin binding protein, 1B,
• Gene location: 11q13.2 (67443820: 67435509)     Exons: 12     NC_000011.10
• Gene summary(Entrez): Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008]
• OMIM: 609849

Protein Summary

• Protein general information: Q9BR76  
  • Name: Coronin 1B (Coronin 2)
  • Length: 489  
  • Mass: 54235
• Sequence:

  MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAY
  PTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLS
  AGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMR
  AIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE
  PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALE
  AEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEA
  GKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA

• Structural information:
  • Interpro: IPR027340  IPR015505  IPR015048  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • DIP: 33176
  • STRING: ENSP00000377471
• Other Databases: GeneCards:  CORO1B  Malacards:  CORO1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0030036	actin cytoskeleton organization	IDA	biological process
GO:0035767	endothelial cell chemotaxis	IMP	biological process
GO:0007015	actin filament organization	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051015	actin filament binding	IDA	molecular function
GO:0042060	wound healing	IDA	biological process
GO:0071933	Arp2/3 complex binding	IDA	molecular function
GO:0071933	Arp2/3 complex binding	IDA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0031252	cell leading edge	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:2000394	positive regulation of lamellipodium morphogenesis	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:1902463	protein localization to cell leading edge	IDA	biological process
GO:0090135	actin filament branching	IDA	biological process
GO:0051017	actin filament bundle assembly	IDA	biological process
GO:0035767	endothelial cell chemotaxis	IDA	biological process
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0031529	ruffle organization	IDA	biological process
GO:0031252	cell leading edge	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IC	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071933	Arp2/3 complex binding	IPI	molecular function
GO:0036120	cellular response to platelet-derived growth factor stimulus	IMP	biological process
GO:0051015	actin filament binding	IMP	molecular function
GO:0071672	negative regulation of smooth muscle cell chemotaxis	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq