• Gene id: 57162

Gene Summary

• Gene Symbol: PELI1   Gene   UCSC   Ensembl
• Gene name: pellino E3 ubiquitin protein ligase 1
• Alternate names: E3 ubiquitin-protein ligase pellino homolog 1, RING-type E3 ubiquitin transferase pellino homolog 1, pellino homolog 1, pellino-1, pellino-related intracellular-signaling molecule, protein pellino homolog 1,
• Gene location: 2p14 (64144420: 64092651)     Exons: 11     NC_000002.12
• OMIM: 614797

Protein Summary

• Protein general information: Q96FA3  
  • Name: E3 ubiquitin protein ligase pellino homolog 1 (Pellino 1) (EC 2.3.2.27) (Pellino related intracellular signaling molecule) (RING type E3 ubiquitin transferase pellino homolog 1)
  • Length: 418  
  • Mass: 46286
  • Tissue specificity: Expressed at high levels in normal skin but decreased in keratinocytes from toxic epidermal necrolysis (TEN) patients (at protein level). {ECO
• Sequence:

  MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQH
  SISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFT
  ARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQ
  QRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
  DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKT
  TAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

• Structural information:
  • Protein Domains: (13..20-)
    (/note="FH-)
    (-)
    (/evidence="ECO:0000250|UniProtKB:Q9HAT8"-)
  • Interpro: IPR006800  
  • DIP: 32488
  • STRING: ENSP00000351789
• Other Databases: GeneCards:  PELI1  Malacards:  PELI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0008063	Toll signaling pathway	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0060546	negative regulation of necroptotic process	IMP	biological process
GO:0070534	protein K63-linked ubiquitination	IMP	biological process
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0008592	regulation of Toll signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034450	ubiquitin-ubiquitin ligase activity	TAS	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	TAS	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070936	protein K48-linked ubiquitination	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0060546	negative regulation of necroptotic process	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0034141	positive regulation of toll-like receptor 3 signaling pathway	IEA	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0050871	positive regulation of B cell activation	IEA	biological process
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0043331	response to dsRNA	IEA	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0031398	positive regulation of protein ubiquitination	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000778	condensed nuclear chromosome kinetochore	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)