• Gene id: 57161

Gene Summary

• Gene Symbol: PELI2   Gene   UCSC   Ensembl
• Gene name: pellino E3 ubiquitin protein ligase family member 2
• Alternate names: E3 ubiquitin-protein ligase pellino homolog 2, RING-type E3 ubiquitin transferase pellino homolog 2, pellino homolog 2, pellino-2, protein pellino homolog 2,
• Gene location: 14q22.3 (56118328: 56301585)     Exons: 12     NC_000014.9
• OMIM: 614798

Protein Summary

• Protein general information: Q9HAT8  
  • Name: E3 ubiquitin protein ligase pellino homolog 2 (Pellino 2) (EC 2.3.2.27) (RING type E3 ubiquitin transferase pellino homolog 2)
  • Length: 420  
  • Mass: 46435
• Sequence:

  MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKAISCKG
  QHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEP
  YTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWREISVCGDVYTLRETRS
  AQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKE
  VVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSE
  KSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID

• Structural information:
  • Protein Domains: (15..20-)
    (/note="FH-)
    (-)
  • Interpro: IPR006800  
  • PDB: 3EGA 3EGB
  • PDBsum: 3EGA 3EGB
  • DIP: 31350
  • STRING: ENSP00000267460
• Other Databases: GeneCards:  PELI2  Malacards:  PELI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0008063	Toll signaling pathway	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0008592	regulation of Toll signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034450	ubiquitin-ubiquitin ligase activity	TAS	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	TAS	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881