• Gene id: 57151

Gene Summary

• Gene Symbol: LYZL6   Gene   UCSC   Ensembl
• Aliases: HEL-S-6a, LYC1, LYZB, PRO1485, TKAL754, UNQ754
• Gene name: lysozyme like 6
• Alternate names: lysozyme-like protein 6, epididymis secretory sperm binding protein Li 6a, lysozyme B, lysozyme homolog,
• Gene location: 17q12 (11273197: 11299571)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residu
• OMIM: 612751

Protein Summary

• Protein general information: O75951  
  • Name: Lysozyme like protein 6 (EC 3.2.1.17)
  • Length: 148  
  • Mass: 16956
  • Tissue specificity: Expressed in testis, epididymis and spermatozoa (at protein level) (PubMed
• Sequence:

  MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLF
  QINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR

• Structural information:
  • Protein Domains: (20..14-)
    (/note="C-type-lysozyme)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00680"-)
  • Interpro: IPR001916  IPR019799  IPR000974  IPR023346  IPR030063  
  • Prosite: PS00128 PS51348
  • STRING: ENSP00000483897
• Other Databases: GeneCards:  LYZL6  Malacards:  LYZL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0097524	sperm plasma membrane	IDA	cellular component
GO:0009566	fertilization	IMP	biological process
GO:0007342	fusion of sperm to egg plasma membrane involved in single fertilization	IMP	biological process
GO:0097225	sperm midpiece	ISS	cellular component
GO:0042742	defense response to bacterium	IMP	biological process
GO:0042742	defense response to bacterium	IMP	biological process
GO:0003796	lysozyme activity	IEA	molecular function
GO:0019835	cytolysis	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007338	single fertilization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0003796	lysozyme activity	IEA	molecular function
GO:0097225	sperm midpiece	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray