• Gene id: 57149

Gene Summary

• Gene Symbol: LYRM1   Gene   UCSC   Ensembl
• Aliases: A211C6.1
• Gene name: LYR motif containing 1
• Alternate names: LYR motif-containing protein 1,
• Gene location: 16p12.3 (20899625: 20925005)     Exons: 13     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the mitochondrial leucine/tyrosine/arginine motif family of proteins. Proteins of this family are short polypeptides that contain a leucine/tyrosine/arginine motif near the N-terminus. This gene is widely expres
• OMIM: 614709

Protein Summary

• Protein general information: O43325  
  • Name: LYR motif containing protein 1
  • Length: 122  
  • Mass: 14282
  • Tissue specificity: High levels in adipose tissue. {ECO
• Sequence:

  MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGL
  HYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS

• Structural information:
  • Interpro: IPR008011  IPR040330  
  • STRING: ENSP00000379367
• Other Databases: GeneCards:  LYRM1  Malacards:  LYRM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray