• Gene id: 57142

Gene Summary

• Gene Symbol: RTN4   Gene   UCSC   Ensembl
• Aliases: ASY, NI220/250, NOGO, NSP, NSP-CL, Nbla00271, Nbla10545, RTN-X, RTN4-A, RTN4-B1, RTN4-B2, RTN4-C
• Gene name: reticulon 4
• Alternate names: reticulon-4, Human NogoA, My043 protein, foocen, neurite growth inhibitor 220, neurite outgrowth inhibitor, neuroendocrine-specific protein C homolog, reticulon 5,
• Gene location: 2p16.1 (55137830: 54972188)     Exons: 17     NC_000002.12
• Gene summary(Entrez): This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent ne
• OMIM: 604475

Protein Summary

• Protein general information: Q9NQC3  
  • Name: Reticulon 4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine specific protein) (NSP) (Neuroendocrine specific protein C homolog) (RTN x) (Reticulon 5)
  • Length: 1192  
  • Mass: 129931
  • Tissue specificity: Isoform A
• Sequence:

  MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAG
  APLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPAS
  VSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFP
  SVLLETAASLPSLSPLSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEM
  GSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVVSSEKAKDSFNEKRVA
  VEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKVDKKCFADSLEQTNHEKDSESSNDDTSFPST
  PEGIKDRSGAYITCAPFNPAATESIATNIFPLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDS
  ETDYVTTDNLTKVTEEVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSF
  EESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYEEAMSVSLKKVSGIKE
  EIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSD
  DSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKK
  EKIPLQMEELSTAVYSNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEI
  ANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALATQAEIESIVKPKVLVK
  EAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSV
  TISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLM
  WVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

• Structural information:
  • Protein Domains: (1005..119-)
    (/note="Reticulon-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00170"-)
  • Interpro: IPR003388  
  • Prosite: PS50845
  • PDB: 2G31 2JV5
  • PDBsum: 2G31 2JV5
  • DIP: 42003
  • STRING: ENSP00000337838
• Other Databases: GeneCards:  RTN4  Malacards:  RTN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0071787	endoplasmic reticulum tubular network formation	IDA	biological process
GO:0071787	endoplasmic reticulum tubular network formation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0098826	endoplasmic reticulum tubular network membrane	IDA	cellular component
GO:0051292	nuclear pore complex assembly	IMP	biological process
GO:0071786	endoplasmic reticulum tubular network organization	IMP	biological process
GO:2000172	regulation of branching morphogenesis of a nerve	ISS	biological process
GO:0021801	cerebral cortex radial glia guided migration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990809	endoplasmic reticulum tubular network membrane organization	IMP	biological process
GO:0034165	positive regulation of toll-like receptor 9 signaling pathway	ISS	biological process
GO:0061462	protein localization to lysosome	ISS	biological process
GO:0007413	axonal fasciculation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050771	negative regulation of axonogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061462	protein localization to lysosome	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0034165	positive regulation of toll-like receptor 9 signaling pathway	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:2000172	regulation of branching morphogenesis of a nerve	IEA	biological process
GO:0090156	cellular sphingolipid homeostasis	IEA	biological process
GO:0060317	cardiac epithelial to mesenchymal transition	IEA	biological process
GO:0051960	regulation of nervous system development	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0021801	cerebral cortex radial glia guided migration	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001825	blastocyst formation	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:1905580	positive regulation of ERBB3 signaling pathway	IMP	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0071782	endoplasmic reticulum tubular network	IDA	cellular component
GO:0033601	positive regulation of mammary gland epithelial cell proliferation	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1905552	positive regulation of protein localization to endoplasmic reticulum	IDA	biological process
GO:0030517	negative regulation of axon extension	IDA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006915	apoptotic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071786	endoplasmic reticulum tubular network organization	IMP	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0005783	endoplasmic reticulum	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray