• Gene id: 57136

Gene Summary

• Gene Symbol: APMAP   Gene   UCSC   Ensembl
• Aliases: BSCv, C20orf3
• Gene name: adipocyte plasma membrane associated protein
• Alternate names: adipocyte plasma membrane-associated protein, protein BSCv,
• Gene location: 20p11.21 (3473645: 3503404)     Exons: 10     NC_000017.11
• OMIM: 615884

Protein Summary

• Protein general information: Q9HDC9  
  • Name: Adipocyte plasma membrane associated protein (Protein BSCv)
  • Length: 416  
  • Mass: 46480
  • Tissue specificity: Liver, glomerular and tubular structures of the kidney, endothelial cells, arterial wall and pancreatic islets of Langerhans (at protein level). Found ubiquitously in adult as well as in embryonic tissues. In adult tissue, the highest
• Sequence:

  MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEP
  PLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCG
  RPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRD
  YLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVEN
  MPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRR
  SLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

• Structural information:
  • Interpro: IPR011042  IPR018119  
  • STRING: ENSP00000217456
• Other Databases: GeneCards:  APMAP  Malacards:  APMAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0009058	biosynthetic process	IEA	biological process
GO:0016844	strictosidine synthase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0004064	arylesterase activity	IDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq