About Us

Search Result


Gene id 57129
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MRPL47   Gene   UCSC   Ensembl
Aliases CGI-204, L47mt, MRP-L47, NCM1
Gene name mitochondrial ribosomal protein L47
Alternate names 39S ribosomal protein L47, mitochondrial, mitochondrial large ribosomal subunit protein uL29m, nasopharyngeal carcinoma metastasis-related 1, nasopharyngeal carcinoma metastasis-related protein 1,
Gene location 3q26.33 (179604645: 179588284)     Exons: 7     NC_000003.12
Gene summary(Entrez) Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
OMIM 611852

Protein Summary

Protein general information Q9HD33  

Name: 39S ribosomal protein L47, mitochondrial (L47mt) (MRP L47) (Mitochondrial large ribosomal subunit protein uL29m) (Nasopharyngeal carcinoma metastasis related protein 1)

Length: 250  Mass: 29450

Sequence MAAAGLALLCRRVSSALKSSRSLITPQVPACTGFFLSLLPKSTPNVTSFHQYRLLHTTLSRKGLEEFFDDPKNWG
QEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQERE
DALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLRLEREKRARIKARKEN
LERKKAKILLKKFPHLAEAQKSSLV
Structural information
Interpro:  IPR038340  IPR010729  

PDB:  
3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
PDBsum:   3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
MINT:  
STRING:   ENSP00000417602
Other Databases GeneCards:  MRPL47  Malacards:  MRPL47

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0008150 biological_process
ND biological process
GO:0003674 molecular_function
ND molecular function
GO:0006412 translation
IEA biological process
GO:0003735 structural constituent of
ribosome
IEA molecular function
GO:0005761 mitochondrial ribosome
IEA cellular component
GO:0032543 mitochondrial translation
IBA biological process
GO:0005762 mitochondrial large ribos
omal subunit
IBA cellular component
GO:0003735 structural constituent of
ribosome
IBA molecular function
GO:0005840 ribosome
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0005743 mitochondrial inner membr
ane
TAS cellular component
GO:0070125 mitochondrial translation
al elongation
TAS biological process
GO:0070126 mitochondrial translation
al termination
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005739 mitochondrion
IEA cellular component
GO:0005762 mitochondrial large ribos
omal subunit
IDA cellular component
GO:0005762 mitochondrial large ribos
omal subunit
IDA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005739 mitochondrion
IDA cellular component
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract