• Gene id: 57125

Gene Summary

• Gene Symbol: PLXDC1   Gene   UCSC   Ensembl
• Aliases: TEM3, TEM7
• Gene name: plexin domain containing 1
• Alternate names: plexin domain-containing protein 1, 2410003I07Rik, tumor endothelial marker 3, tumor endothelial marker 7,
• Gene location: 17q12 (39151636: 39063312)     Exons: 14     NC_000017.11
• OMIM: 190182

Protein Summary

• Protein general information: Q8IUK5  
  • Name: Plexin domain containing protein 1 (Tumor endothelial marker 3) (Tumor endothelial marker 7)
  • Length: 500  
  • Mass: 55760
  • Tissue specificity: Detected in endothelial cells from colorectal cancer, and in endothelial cells from primary cancers of the lung, liver, pancreas, breast and brain. Not detectable in endothelial cells from normal tissue. Expressed in fibrovascular memb
• Sequence:

  MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLGGGTLAMD
  TLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFDFPFYGHPLRQ
  ITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGWEDKGSFTFQAAL
  HHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEYHRIELDPSKVTSMSAVEFTP
  LPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSP
  YDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLGTIVGIVLAVLLVAAIILAGIYINGH
  PTSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHEKEGFMEAEQC

• Structural information:
  • Interpro: IPR002165  IPR031152  IPR031153  
  • STRING: ENSP00000323927
• Other Databases: GeneCards:  PLXDC1  Malacards:  PLXDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0021510	spinal cord development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001525	angiogenesis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881