• Gene id: 57122

Gene Summary

• Gene Symbol: NUP107   Gene   UCSC   Ensembl
• Aliases: NPHS11, NUP84, ODG6, ODG6; GAMOS7
• Gene name: nucleoporin 107
• Alternate names: nuclear pore complex protein Nup107, nucleoporin 107kDa,
• Gene location: 12q15 (68686970: 68745808)     Exons: 28     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is an essential component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transpo
• OMIM: 607617

Protein Summary

• Protein general information: P57740  
  • Name: Nuclear pore complex protein Nup107 (107 kDa nucleoporin) (Nucleoporin Nup107)
  • Length: 925  
  • Mass: 106374
  • Tissue specificity: Ubiquitously expressed in fetal and adult tissues. {ECO
• Sequence:

  MDRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFRQPFTPTSRSLLRQPD
  ISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVMLREDDPGEAA
  SMSMFSDFLQSFLKHSSSTVFDLVEEYENICGSQVNILSKIVSRATPGLQKFSKTASMLWLLQQEMVTWRLLASL
  YRDRIQSALEEESVFAVTAVNASEKTVVEALFQRDSLVRQSQLVVDWLESIAKDEIGEFSDNIEFYAKSVYWENT
  LHTLKQRQLTSYVGSVRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYLFTLIRAGMTEEAQRLCKRCGQAWRA
  ATLEGWKLYHDPNVNGGTELEPVEGNPYRRIWKISCWRMAEDELFNRYERAIYAALSGNLKQLLPVCDTWEDTVW
  AYFRVMVDSLVEQEIQTSVATLDETEELPREYLGANWTLEKVFEELQATDKKRVLEENQEHYHIVQKFLILGDID
  GLMDEFSKWLSKSRNNLPGHLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDL
  AVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAPALDTGTTEEDRLKIDVI
  DWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCI
  RAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVD
  GGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKL
  LQKLRESSLMLLDQGLDPLGYEIQL

• Structural information:
  • Interpro: IPR007252  
  • PDB: 3CQC 3CQG 3I4R 5A9Q
  • PDBsum: 3CQC 3CQG 3I4R 5A9Q
  • STRING: ENSP00000229179
• Other Databases: GeneCards:  NUP107  Malacards:  NUP107

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031080	nuclear pore outer ring	IBA	cellular component
GO:0017056	structural constituent of nuclear pore	IBA	molecular function
GO:0006606	protein import into nucleus	IBA	biological process
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0000973	posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery	IBA	biological process
GO:0034399	nuclear periphery	IDA	cellular component
GO:0031080	nuclear pore outer ring	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0000776	kinetochore	IDA	colocalizes with
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0051292	nuclear pore complex assembly	IMP	biological process
GO:0031080	nuclear pore outer ring	NAS	cellular component
GO:0031080	nuclear pore outer ring	NAS	cellular component
GO:0017056	structural constituent of nuclear pore	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072006	nephron development	IMP	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0017056	structural constituent of nuclear pore	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0017056	structural constituent of nuclear pore	IDA	molecular function
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0008585	female gonad development	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Nephrotic syndrome	KEGG:H01657
Galloway-Mowat syndrome	KEGG:H01722
Nephrotic syndrome	KEGG:H01657
Galloway-Mowat syndrome	KEGG:H01722
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq