• Gene id: 57120

Gene Summary

• Gene Symbol: GOPC   Gene   UCSC   Ensembl
• Aliases: CAL, FIG, GOPC1, PIST, dJ94G16.2
• Gene name: golgi associated PDZ and coiled-coil motif containing
• Alternate names: Golgi-associated PDZ and coiled-coil motif-containing protein, CFTR-associated ligand, PDZ protein interacting specifically with TC10, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, dJ94G16.2 PIST, fused in glioblastoma, golgi-asso,
• Gene location: 6q22.1 (117602541: 117560268)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are i
• OMIM: 606845

Protein Summary

• Protein general information: Q9HD26  
  • Name: Golgi associated PDZ and coiled coil motif containing protein (CFTR associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST)
  • Length: 462  
  • Mass: 50,520
• Sequence:

  MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSS
  CFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKL
  SGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLG
  RDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
  ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVD
  SDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKL
  DDLHTLYHKKSY

• Structural information:
  • Protein Domains: PDZ. (288-371)
  • Interpro: IPR001478  IPR036034  
  • Prosite: PS50106
  • PDB: 2DC2 2LOB 4E34 4E35 4JOE 4JOF 4JOG 4JOH 4JOJ 4JOK 4JOP 4JOR 4K6Y 4K72 4K75 4K76 4K78 4NMO 4NMP 4NMQ 4NMR 4NMS 4NMT 4NMV 4Q6H 4Q6S 5IC3 5K4F
  • PDBsum: 2DC2 2LOB 4E34 4E35 4JOE 4JOF 4JOG 4JOH 4JOJ 4JOK 4JOP 4JOR 4K6Y 4K72 4K75 4K76 4K78 4NMO 4NMP 4NMQ 4NMR 4NMS 4NMT 4NMV 4Q6H 4Q6S 5IC3 5K4F
  • STRING: ENSP00000357484
• Other Databases: GeneCards:  GOPC  Malacards:  GOPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	ER to Golgi vesicle-mediated transport	NAS	biological process
GO:0006893	Golgi to plasma membrane transport	NAS	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	NAS	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0043004	cytoplasmic sequestering of CFTR protein	NAS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0045176	apical protein localization	NAS	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IPI	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006810	transport	IEA	biological process
GO:0006888	ER to Golgi vesicle-mediated transport	NAS	biological process
GO:0006893	Golgi to plasma membrane transport	NAS	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	NAS	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0043004	cytoplasmic sequestering of CFTR protein	NAS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0045176	apical protein localization	NAS	biological process
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IPI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	ER to Golgi vesicle-mediated transport	NAS	biological process
GO:0006893	Golgi to plasma membrane transport	NAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	NAS	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0043004	cytoplasmic sequestering of CFTR protein	NAS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0045176	apical protein localization	NAS	biological process
GO:0051260	protein homooligomerization	IPI	biological process

Diseases

Associated diseases	References
Globozoospermia	MIK: 16551740
Male factor infertility	MIK: 16551740
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Causes infertile round-headed spermatozoa, which have acrosome-less round heads and deformed tails	MIK: 15700542
Globozoospermia	MIK: 16551740
Male infertility	MIK: 16551740
Role in acrosome biogenesis	MIK: 19258705
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16551740	Globozoospermia, male infertility	Hrb (19081 A DEL, 39 T/C: V139A, 751 T/C (rs7588620), 38 A/G: T472T (rs13426422), 538 A/G (rs13382948)), Csnk2a2 (509 A/G (rs16959755), 839 T/C, 919 A/G (rs2242444), 410 C/A (rs2242445)), GOPC (509 A/G, 531 T/G, 556 C/T, 445 G/A, 612 G/A)		10 (Family1: 1 primary infertility, I globozoospermia, 5 fertile, Family 2: 1 primary infertility, I globozoospermia, 1 fertile)	Male infertility	Hrb GOPC Csnk2a2
19258705	Role in acrosome biogenesis, Male infertility				Male infertility
15700542	Causes infertile round-headed spermatozoa, which have acrosome-less round heads and deformed tails				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)