• Gene id: 57118

Gene Summary

• Gene Symbol: CAMK1D   Gene   UCSC   Ensembl
• Aliases: CKLiK, CaM-K1, CaMKID
• Gene name: calcium/calmodulin dependent protein kinase ID
• Alternate names: calcium/calmodulin-dependent protein kinase type 1D, CAMK1D/ANAPC5 fusion, CaM kinase ID, CamKI-like protein kinase, caM kinase I delta, caM-KI delta, caMKI delta,
• Gene location: 10p13 (176002690: 175632936)     Exons: 11     NC_000004.12
• Gene summary(Entrez): This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated
• OMIM: 607957

Protein Summary

• Protein general information: Q8IU85  
  • Name: Calcium/calmodulin dependent protein kinase type 1D (EC 2.7.11.17) (CaM kinase I delta) (CaM kinase ID) (CaM KI delta) (CaMKI delta) (CaMKID) (CaMKI like protein kinase) (CKLiK)
  • Length: 385  
  • Mass: 42914
  • Tissue specificity: Widely expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes. {ECO
• Sequence:

  MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRK
  IKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENL
  LYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
  DSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
  FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSSSGVSGVGAERRPRPT
  TVTAVHSGSK

• Structural information:
  • Protein Domains: (23..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2JC6 6T28 6T29 6T6F
  • PDBsum: 2JC6 6T28 6T29 6T6F
  • STRING: ENSP00000478874
• Other Databases: GeneCards:  CAMK1D  Malacards:  CAMK1D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004683	calmodulin-dependent protein kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0032793	positive regulation of CREB transcription factor activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071622	regulation of granulocyte chemotaxis	IMP	biological process
GO:0060267	positive regulation of respiratory burst	IMP	biological process
GO:0050773	regulation of dendrite development	IMP	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	ISS	biological process
GO:0050766	positive regulation of phagocytosis	IMP	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa05214	Glioma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq