• Gene id: 57117

Gene Summary

• Gene Symbol: INTS12   Gene   UCSC   Ensembl
• Aliases: INT12, PHF22, SBBI22
• Gene name: integrator complex subunit 12
• Alternate names: integrator complex subunit 12, PHD finger protein 22, hypothetical nuclear factor SBBI22,
• Gene location: 4q24 (105708724: 105682626)     Exons: 10     NC_000004.12
• Gene summary(Entrez): INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (B
• OMIM: 605950

Protein Summary

• Protein general information: Q96CB8  
  • Name: Integrator complex subunit 12 (Int12) (PHD finger protein 22)
  • Length: 462  
  • Mass: 48808
• Sequence:

  MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISS
  SLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETS
  ADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCARCTRQMKRMAQKTQK
  PPQKPAPAVVSVTPAVKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSASVSSSVTSGLTGWAAFAAKT
  SSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTTPTVPLKPPPPLTLGKTGLSR
  SVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKTTSESSSSPSASLKGPTSQESQLNAMKRLQM
  VKKKAAQKKLKK

• Structural information:
  • Interpro: IPR039053  IPR039054  IPR019786  IPR011011  IPR001965   IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • CDD: cd15501
  • DIP: 48479
  • STRING: ENSP00000415433
• Other Databases: GeneCards:  INTS12  Malacards:  INTS12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032039	integrator complex	IDA	cellular component
GO:0016180	snRNA processing	IDA	biological process
GO:0032039	integrator complex	IBA	cellular component
GO:0034472	snRNA 3'-end processing	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016180	snRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032039	integrator complex	IDA	cellular component
GO:0016180	snRNA processing	IDA	biological process
GO:0032039	integrator complex	IBA	cellular component
GO:0034472	snRNA 3'-end processing	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016180	snRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881