• Gene id: 57115

Gene Summary

• Gene Symbol: PGLYRP4   Gene   UCSC   Ensembl
• Aliases: PGLYRPIbeta, PGRP-Ibeta, PGRPIB, SBBI67
• Gene name: peptidoglycan recognition protein 4
• Alternate names: peptidoglycan recognition protein 4, PGRP-I-beta, peptidoglycan recognition protein I-beta, peptidoglycan recognition protein intermediate beta,
• Gene location: 1q21.3 (153348843: 153327409)     Exons: 5     NC_000001.11
• Gene summary(Entrez): Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell wal
• OMIM: 608198

Protein Summary

• Protein general information: Q96LB8  
  • Name: Peptidoglycan recognition protein 4 (Peptidoglycan recognition protein I beta) (PGLYRPIbeta) (PGRP I beta) (Peptidoglycan recognition protein intermediate beta)
  • Length: 373  
  • Mass: 40620
  • Tissue specificity: Detected in skin epidermis, eccrine sweat glands and ducts, mucous cells in the submandibular salivary gland, mucous cells in the throat, ciliary body epithelial cells of the eye, small intestine, colon, stomach and in mature epithelia
• Sequence:

  MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSIQLTTP
  VNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHTQGYNNISLGF
  AFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKACPGVVPRSVWGARETH
  CPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGY
  DDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHFKH

• Structural information:
  • Protein Domains: (74..21-)
    1 (/note="N-acetylmuramoyl-L-alanine-amidase)
    (/evidence="ECO:0000255-)
    (235..35-)
    2 (/note="N-acetylmuramoyl-L-alanine-amidase)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR036505  IPR002502  IPR015510  IPR006619  
  • CDD: cd06583
  • PDB: 2EAV 2EAX
  • PDBsum: 2EAV 2EAX
  • STRING: ENSP00000352672
• Other Databases: GeneCards:  PGLYRP4  Malacards:  PGLYRP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IBA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0016045	detection of bacterium	IBA	biological process
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IEA	molecular function
GO:0009253	peptidoglycan catabolic process	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0016045	detection of bacterium	IDA	biological process
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0031640	killing of cells of other organism	IDA	biological process
GO:0045087	innate immune response	NAS	biological process
GO:0016020	membrane	NAS	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq