• Gene id: 57113

Gene Summary

• Gene Symbol: TRPC7   Gene   UCSC   Ensembl
• Aliases: TRP7
• Gene name: transient receptor potential cation channel subfamily C member 7
• Alternate names: short transient receptor potential channel 7, likley ortholog of mouse transient receptor potential cation channel, subfamily C, member 7, putative capacitative calcium channel, transient receptor protein 7,
• Gene location: 5q31.1 (136365544: 136212744)     Exons: 12     NC_000005.10

Protein Summary

• Protein general information: Q9HCX4  
  • Name: Short transient receptor potential channel 7 (TrpC7) (Transient receptor protein 7) (TRP 7) (hTRP7)
  • Length: 862  
  • Mass: 99562
• Sequence:

  MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVD
  YMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLSPLEQELRDDD
  FYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGL
  ASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVW
  SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCS
  KLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGM
  IWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFT
  YARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
  YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNS
  YQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLN
  SKFKKTRYQAGMRNSENLTANNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLE
  EKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR005821  IPR013555   IPR005463  IPR002153  
  • STRING: ENSP00000426070
• Other Databases: GeneCards:  TRPC7  Malacards:  TRPC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006828	manganese ion transport	IBA	biological process
GO:0015279	store-operated calcium channel activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0007338	single fertilization	IBA	biological process
GO:0034703	cation channel complex	IBA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0070679	inositol 1,4,5 trisphosphate binding	IBA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0006828	manganese ion transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq