• Gene id: 57111

Gene Summary

• Gene Symbol: RAB25   Gene   UCSC   Ensembl
• Aliases: CATX-8, RAB11C
• Gene name: RAB25, member RAS oncogene family
• Alternate names: ras-related protein Rab-25,
• Gene location: 1q22 (156061159: 156070503)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. T
• OMIM: 612942

Protein Summary

• Protein general information: P57735  
  • Name: Ras related protein Rab 25 (CATX 8)
  • Length: 213  
  • Mass: 23496
  • Tissue specificity: Expressed in ovarian epithelium (NOE) and breast tissue. Expressed in ovarian cancer; expression is increased relative to NOE cells. Expression in ovarian cancer is stage dependent, with stage III and stage IV showing higher levels tha
• Sequence:

  MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYR
  AITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENNGLL
  FLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACCISL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 2OIL 3TSO
  • PDBsum: 2OIL 3TSO
  • STRING: ENSP00000354376
• Other Databases: GeneCards:  RAB25  Malacards:  RAB25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055037	recycling endosome	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0031268	pseudopodium organization	IDA	biological process
GO:0031143	pseudopodium	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003382	epithelial cell morphogenesis	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031260	pseudopodium membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0060627	regulation of vesicle-mediated transport	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq