• Gene id: 57110

Gene Summary

• Gene Symbol: PLAAT1   Gene   UCSC   Ensembl
• Aliases: A-C1, H-REV107, HRASLS, HRASLS1, HRSL1, HSD28, PLA/AT1, PLAAT-1
• Gene name: phospholipase A and acyltransferase 1
• Alternate names: phospholipase A and acyltransferase 1, H-REV107 protein-related protein, HRAS like suppressor, HRAS-like suppressor 1, phospholipase A, phospholipase A/acyltransferase 1, phospholipid-metabolizing enzyme A-C1,
• Gene location: 3q29 (193241127: 193281638)     Exons: 8     NC_000003.12
• OMIM: 606487

Protein Summary

• Protein general information: Q9HDD0  
  • Name: Phospholipase A and acyltransferase 1 (EC 2.3.1. ) (EC 3.1.1.32) (EC 3.1.1.4) (HRAS like suppressor 1) (HRSL1) (Phospholipid metabolizing enzyme A C1)
  • Length: 168  
  • Mass: 18750
  • Tissue specificity: Isoform 1 is abundantly expressed in testis, skeletal muscle, brain, and heart (PubMed
• Sequence:

  MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVV
  GNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAV
  GVFSFLGLFPKGQRAKYY

• Structural information:
  • Interpro: IPR007053  
  • STRING: ENSP00000264735
• Other Databases: GeneCards:  PLAAT1  Malacards:  PLAAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016410	N-acyltransferase activity	IBA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IBA	biological process
GO:0008970	phospholipase A1 activity	IBA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0008374	O-acyltransferase activity	IDA	molecular function
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005641	nuclear envelope lumen	ISS	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray