• Gene id: 57109

Gene Summary

• Gene Symbol: REXO4   Gene   UCSC   Ensembl
• Aliases: REX4, XPMC2, XPMC2H
• Gene name: REX4 homolog, 3'-5' exonuclease
• Alternate names: RNA exonuclease 4, REX4, RNA exonuclease 4 homolog, XPMC2 prevents mitotic catastrophe 2 homolog, Xenopus prevents mitotic catastrophe 2 homolog, exonuclease XPMC2,
• Gene location: 9q34.2 (157981855: 158099175)     Exons: 31     NC_000006.12
• OMIM: 602930

Protein Summary

• Protein general information: Q9GZR2  
  • Name: RNA exonuclease 4 (EC 3.1. . ) (Exonuclease XPMC2) (Prevents mitotic catastrophe 2 protein homolog) (hPMC2)
  • Length: 422  
  • Mass: 46672
• Sequence:

  MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQE
  WLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKAS
  GTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEG
  SVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPEN
  LKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQ
  VQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

• Structural information:
  • Protein Domains: (243..39-)
    (/note="Exonuclease"-)
  • Interpro: IPR013520  IPR034920  IPR037431  IPR012337  IPR036397  
  • CDD: cd06144
  • STRING: ENSP00000361010
• Other Databases: GeneCards:  REXO4  Malacards:  REXO4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0004519	endonuclease activity	IDA	molecular function
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0000726	non-recombinational repair	IDA	biological process
GO:0000738	DNA catabolic process, exonucleolytic	IDA	biological process
GO:0000737	DNA catabolic process, endonucleolytic	IDA	biological process
GO:0000726	non-recombinational repair	IBA	biological process
GO:0000738	DNA catabolic process, exonucleolytic	IBA	biological process
GO:0000737	DNA catabolic process, endonucleolytic	IBA	biological process
GO:0004527	exonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0008408	3'-5' exonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray