• Gene id: 57107

Gene Summary

• Gene Symbol: PDSS2   Gene   UCSC   Ensembl
• Aliases: C6orf210, COQ10D3, COQ1B, DLP1, bA59I9.3, hDLP1
• Gene name: decaprenyl diphosphate synthase subunit 2
• Alternate names: decaprenyl-diphosphate synthase subunit 2, all-trans-decaprenyl-diphosphate synthase subunit 2, decaprenyl pyrophosphate synthase subunit 2, decaprenyl pyrophosphate synthetase subunit 2, prenyl (decaprenyl) diphosphate synthase, subunit 2, subunit 2 of decapr,
• Gene location: 6q21 (81927734: 81918269)     Exons: 4     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isope
• OMIM: 610564

Protein Summary

• Protein general information: Q86YH6  
  • Name: Decaprenyl diphosphate synthase subunit 2 (EC 2.5.1.91) (All trans decaprenyl diphosphate synthase subunit 2) (Candidate tumor suppressor protein) (Decaprenyl pyrophosphate synthase subunit 2)
  • Length: 399  
  • Mass: 44129
• Sequence:

  MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSD
  ELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAE
  ITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQG
  VYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF
  IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTSAIDLCRYHGNKALEA
  LESFPPSEARSALENIVFAVTRFS

• Structural information:
  • Interpro: IPR008949  IPR000092  
  • STRING: ENSP00000358033
• Other Databases: GeneCards:  PDSS2  Malacards:  PDSS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008299	isoprenoid biosynthetic process	IDA	biological process
GO:0006744	ubiquinone biosynthetic process	IDA	biological process
GO:0000010	trans-hexaprenyltranstransferase activity	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0006744	ubiquinone biosynthetic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004659	prenyltransferase activity	IBA	molecular function
GO:1990234	transferase complex	IBA	cellular component
GO:0008299	isoprenoid biosynthetic process	IBA	biological process
GO:0008299	isoprenoid biosynthetic process	IEA	biological process
GO:0008299	isoprenoid biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006744	ubiquinone biosynthetic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006744	ubiquinone biosynthetic process	TAS	biological process
GO:0000010	trans-hexaprenyltranstransferase activity	IEA	molecular function
GO:0006744	ubiquinone biosynthetic process	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0050347	trans-octaprenyltranstransferase activity	IEA	molecular function
GO:0008299	isoprenoid biosynthetic process	IEA	biological process
GO:0050878	regulation of body fluid levels	IEA	biological process
GO:1990234	transferase complex	IEA	cellular component
GO:1990234	transferase complex	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006744	ubiquinone biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00900	Terpenoid backbone biosynthesis

Diseases

Associated diseases	References
Coenzyme Q10 deficiency	KEGG:H00999
Coenzyme Q10 deficiency	KEGG:H00999
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray