• Gene id: 57103

Gene Summary

• Gene Symbol: TIGAR   Gene   UCSC   Ensembl
• Aliases: C12orf5, FR2BP
• Gene name: TP53 induced glycolysis regulatory phosphatase
• Alternate names: fructose-2,6-bisphosphatase TIGAR, TP53-induced glycolysis and apoptosis regulator, fructose-2,6-bisphosphate 2-phosphatase, probable fructose-2,6-bisphosphatase TIGAR, transactivated by NS3TP2 protein,
• Gene location: 12p13.32 (4321212: 4360027)     Exons: 6     NC_000012.12
• Gene summary(Entrez): This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and
• OMIM: 600282

Protein Summary

• Protein general information: Q9NQ88  
  • Name: Fructose 2,6 bisphosphatase TIGAR (EC 3.1.3.46) (TP53 induced glycolysis and apoptosis regulator) (TP53 induced glycolysis regulatory phosphatase)
  • Length: 270  
  • Mass: 30063
  • Tissue specificity: Expressed in the brain (PubMed
• Sequence:

  MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKF
  CKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQK
  EQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSE
  LMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR

• Structural information:
  • Interpro: IPR013078  IPR029033  IPR001345  
  • Prosite: PS00175
  • CDD: cd07067
  • PDB: 3DCY
  • PDBsum: 3DCY
  • DIP: 60093
  • STRING: ENSP00000179259
• Other Databases: GeneCards:  TIGAR  Malacards:  TIGAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004331	fructose-2,6-bisphosphate 2-phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0043069	negative regulation of programmed cell death	IBA	biological process
GO:0004083	bisphosphoglycerate 2-phosphatase activity	IBA	molecular function
GO:0006003	fructose 2,6-bisphosphate metabolic process	IBA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IBA	biological process
GO:0043456	regulation of pentose-phosphate shunt	IBA	biological process
GO:0045739	positive regulation of DNA repair	IBA	biological process
GO:0045820	negative regulation of glycolytic process	IBA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0043069	negative regulation of programmed cell death	IDA	biological process
GO:0004331	fructose-2,6-bisphosphate 2-phosphatase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:1903301	positive regulation of hexokinase activity	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0071279	cellular response to cobalt ion	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004083	bisphosphoglycerate 2-phosphatase activity	IDA	molecular function
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0006003	fructose 2,6-bisphosphate metabolic process	IDA	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:1902153	regulation of response to DNA damage checkpoint signaling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043456	regulation of pentose-phosphate shunt	IMP	biological process
GO:0045739	positive regulation of DNA repair	IMP	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0004331	fructose-2,6-bisphosphate 2-phosphatase activity	IEA	molecular function
GO:0004331	fructose-2,6-bisphosphate 2-phosphatase activity	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0010666	positive regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0004331	fructose-2,6-bisphosphate 2-phosphatase activity	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:1904024	negative regulation of glucose catabolic process to lactate via pyruvate	IEA	biological process
GO:1901525	negative regulation of mitophagy	IEA	biological process
GO:0060576	intestinal epithelial cell development	IEA	biological process
GO:0045820	negative regulation of glycolytic process	IEA	biological process
GO:0009410	response to xenobiotic stimulus	IEA	biological process
GO:0006003	fructose 2,6-bisphosphate metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05230	Central carbon metabolism in cancer
hsa00051	Fructose and mannose metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq