• Gene id: 57094

Gene Summary

• Gene Symbol: CPA6   Gene   UCSC   Ensembl
• Aliases: CPAH, ETL5, FEB11
• Gene name: carboxypeptidase A6
• Alternate names: carboxypeptidase A6, carboxypeptidase B,
• Gene location: 8q13.2 (67747113: 67422037)     Exons: 13     NC_000008.11
• Gene summary(Entrez): The gene encodes a member of the peptidase M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature enzyme, which catalyzes the release of large hydrophobic C-terminal amino acids. This enzyme h
• OMIM: 600682

Protein Summary

• Protein general information: Q8N4T0  
  • Name: Carboxypeptidase A6 (EC 3.4.17. )
  • Length: 437  
  • Mass: 51008
  • Tissue specificity: Expressed in the hippocampus, nucleus raphe, and cortex. {ECO
• Sequence:

  MKCLGKRRGQAAAFLPLCWLFLKILQPGHSHLYNNRYAGDKVIRFIPKTEEEAYALKKISYQLKVDLWQPSSISY
  VSEGTVTDVHIPQNGSRALLAFLQEANIQYKVLIEDLQKTLEKGSSLHTQRNRRSLSGYNYEVYHSLEEIQNWMH
  HLNKTHSGLIHMFSIGRSYEGRSLFILKLGRRSRLKRAVWIDCGIHAREWIGPAFCQWFVKEALLTYKSDPAMRK
  MLNHLYFYIMPVFNVDGYHFSWTNDRFWRKTRSRNSRFRCRGVDANRNWKVKWCDEGASMHPCDDTYCGPFPESE
  PEVKAVANFLRKHRKHIRAYLSFHAYAQMLLYPYSYKYATIPNFRCVESAAYKAVNALQSVYGVRYRYGPASTTL
  YVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFLLPEMLIKPTCTETMLAVKNITMHLLKKCP

• Structural information:
  • Interpro: IPR036990  IPR003146  IPR000834  
  • Prosite: PS00133
  • STRING: ENSP00000297770
• Other Databases: GeneCards:  CPA6  Malacards:  CPA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Febrile seizures	KEGG:H00783
Familial epilepsy temporal lobe	KEGG:H00809
Febrile seizures	KEGG:H00783
Familial epilepsy temporal lobe	KEGG:H00809
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881