• Gene id: 57060

Gene Summary

• Gene Symbol: PCBP4   Gene   UCSC   Ensembl
• Aliases: CBP, LIP4, MCG10
• Gene name: poly(rC) binding protein 4
• Alternate names: poly(rC)-binding protein 4, LYST-interacting protein, RNA binding protein MCG10, alpha-CP4,
• Gene location: 3p21.2 (51967465: 51957453)     Exons: 15     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
• OMIM: 608503

Protein Summary

• Protein general information: P57723  
  • Name: Poly(rC) binding protein 4 (Alpha CP4)
  • Length: 403  
  • Mass: 41482
• Sequence:

  MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTAAVFHA
  VSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAV
  TVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVP
  FATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
  AQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGLKPMPFLALPPASPGP
  PPGLAAYTAKMAAANGSKKAERQKFSPY

• Structural information:
  • Protein Domains: (17..6-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (101..15-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (241..29-)
    (/note="KH-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  IPR033088  
  • Prosite: PS50084
  • STRING: ENSP00000417196
• Other Databases: GeneCards:  PCBP4  Malacards:  PCBP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0048025	negative regulation of mRNA splicing, via spliceosome	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)