• Gene id: 57053

Gene Summary

• Gene Symbol: CHRNA10   Gene   UCSC   Ensembl
• Gene name: cholinergic receptor nicotinic alpha 10 subunit
• Alternate names: neuronal acetylcholine receptor subunit alpha-10, NACHR alpha-10, acetylcholine receptor, nicotinic, alpha 10 (neuronal), cholinergic receptor, nicotinic alpha 10, cholinergic receptor, nicotinic, alpha 10 (neuronal), cholinergic receptor, nicotinic, alpha pol,
• Gene location: 11p15.4 (3673628: 3665586)     Exons: 3     NC_000011.10
• OMIM: 606372

Protein Summary

• Protein general information: Q9GZZ6  
  • Name: Neuronal acetylcholine receptor subunit alpha 10 (Nicotinic acetylcholine receptor subunit alpha 10) (NACHR alpha 10)
  • Length: 450  
  • Mass: 49705
  • Tissue specificity: Expressed in inner-ear tissue, tonsil, immortalized B-cells, cultured T-cells and peripheral blood lymphocytes. {ECO
• Sequence:

  MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQV
  LTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAIT
  RSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPD
  VTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
  YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQSRPPELSPSPQSPEGG
  AGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWKRLARVMDRFFLAIFFSMALVMSLLVLVQAL

• Structural information:
  • Interpro: IPR006202  IPR036734  IPR006201  IPR036719  IPR006029   IPR018000  IPR002394  
  • Prosite: PS00236
  • STRING: ENSP00000250699
• Other Databases: GeneCards:  CHRNA10  Malacards:  CHRNA10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045202	synapse	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0050877	nervous system process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0022848	acetylcholine-gated cation-selective channel activity	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0022848	acetylcholine-gated cation-selective channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IGI	biological process
GO:0050910	detection of mechanical stimulus involved in sensory perception of sound	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0022848	acetylcholine-gated cation-selective channel activity	IEA	molecular function
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0098981	cholinergic synapse	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0007271	synaptic transmission, cholinergic	IEA	biological process
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0007271	synaptic transmission, cholinergic	TAS	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0042127	regulation of cell population proliferation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq