• Gene id: 57050

Gene Summary

• Gene Symbol: UTP3   Gene   UCSC   Ensembl
• Aliases: CRL1, CRLZ1, SAS10
• Gene name: UTP3 small subunit processome component
• Alternate names: something about silencing protein 10, UTP3 homolog, UTP3, small subunit processome component homolog, charged amino acid rich leucine zipper 1 homolog, charged amino acid-rich leucine zipper 1, disrupter of silencing 10, disrupter of silencing SAS10,
• Gene location: 4q13.3 (70688531: 70690550)     Exons: 36     NC_000004.12
• OMIM: 611614

Protein Summary

• Protein general information: Q9NQZ2  
  • Name: Something about silencing protein 10 (Charged amino acid rich leucine zipper 1) (CRL1) (Disrupter of silencing SAS10) (UTP3 homolog)
  • Length: 479  
  • Mass: 54558
• Sequence:

  MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDG
  EEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQS
  QQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPE
  LLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIER
  LVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAK
  LKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQ
  VREVRKEEQRYSGELSGIRAGVKKSIKLK

• Structural information:
  • Interpro: IPR007146  IPR018972  
  • STRING: ENSP00000254803
• Other Databases: GeneCards:  UTP3  Malacards:  UTP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032040	small-subunit processome	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0007420	brain development	ISS	biological process
GO:0005634	nucleus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881