• Gene id: 57047

Gene Summary

• Gene Symbol: PLSCR2   Gene   UCSC   Ensembl
• Gene name: phospholipid scramblase 2
• Alternate names: phospholipid scramblase 2, PL scramblase 2, ca(2+)-dependent phospholipid scramblase 2,
• Gene location: 3q24 (146497162: 146391362)     Exons: 26     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the phospholipid scramblase family. Phospholipid scramblases are membrane proteins that mediate calcium-dependent, non-specific movement of plasma membrane phospholipids and phosphatidylserine exposure. The encoded protein co

Protein Summary

• Protein general information: Q9NRY7  
  • Name: Phospholipid scramblase 2 (PL scramblase 2) (Ca(2+) dependent phospholipid scramblase 2)
  • Length: 297  
  • Mass: 33504
  • Tissue specificity: Expression of isoform 1 seems restricted to testis. {ECO
• Sequence:

  MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEGVPWMP
  APPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTL
  RITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVC
  SCIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFERTR

• Structural information:
  • Interpro: IPR005552  
  • STRING: ENSP00000420132
• Other Databases: GeneCards:  PLSCR2  Malacards:  PLSCR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0017121	plasma membrane phospholipid scrambling	IBA	biological process
GO:0017128	phospholipid scramblase activity	IBA	molecular function
GO:0017121	plasma membrane phospholipid scrambling	IEA	biological process
GO:0017128	phospholipid scramblase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0017128	phospholipid scramblase activity	NAS	molecular function
GO:0005509	calcium ion binding	NAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0017121	plasma membrane phospholipid scrambling	NAS	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray