• Gene id: 57045

Gene Summary

• Gene Symbol: TWSG1   Gene   UCSC   Ensembl
• Aliases: TSG
• Gene name: twisted gastrulation BMP signaling modulator 1
• Alternate names: twisted gastrulation protein homolog 1, twisted gastrulation homolog 1,
• Gene location: 18p11.22 (9334772: 9402419)     Exons: 5     NC_000018.10
• OMIM: 612880

Protein Summary

• Protein general information: Q9GZX9  
  • Name: Twisted gastrulation protein homolog 1
  • Length: 223  
  • Mass: 25017
• Sequence:

  MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVG
  MCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSV
  PSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

• Structural information:
  • Interpro: IPR006761  
  • STRING: ENSP00000262120
• Other Databases: GeneCards:  TWSG1  Malacards:  TWSG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030510	regulation of BMP signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030513	positive regulation of BMP signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001503	ossification	IEA	biological process
GO:0043010	camera-type eye development	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0009888	tissue development	IEA	biological process
GO:0007435	salivary gland morphogenesis	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0050431	transforming growth factor beta binding	IDA	molecular function
GO:0001818	negative regulation of cytokine production	IDA	biological process
GO:2000515	negative regulation of CD4-positive, alpha-beta T cell activation	IDA	biological process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)