• Gene id: 57037

Gene Summary

• Gene Symbol: ANKMY2   Gene   UCSC   Ensembl
• Aliases: ZMYND20
• Gene name: ankyrin repeat and MYND domain containing 2
• Alternate names: ankyrin repeat and MYND domain-containing protein 2,
• Gene location: 7p21.1 (16645815: 16599778)     Exons: 11     NC_000007.14

Protein Summary

• Protein general information: Q8IV38  
  • Name: Ankyrin repeat and MYND domain containing protein 2
  • Length: 441  
  • Mass: 49299
• Sequence:

  MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCH
  QHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGL
  DKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMKQRDMNEVLAMKMHYI
  SCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTA
  FSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFTHKKICKNLKDIYEKQQLEAAKEK
  RQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESLESEAELEGLQDAPAGPQVSEE

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR002893  
  • Prosite: PS50297 PS50088 PS01360 PS50865
  • STRING: ENSP00000303570
• Other Databases: GeneCards:  ANKMY2  Malacards:  ANKMY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)