• Gene id: 57030

Gene Summary

• Gene Symbol: SLC17A7   Gene   UCSC   Ensembl
• Aliases: BNPI, VGLUT1
• Gene name: solute carrier family 17 member 7
• Alternate names: vesicular glutamate transporter 1, brain-specific Na(+)-dependent inorganic phosphate cotransporter, brain-specific Na-dependent inorganic phosphate cotransporter, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7, solute,
• Gene location: 19q13.33 (49441526: 49429400)     Exons: 12     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in gl

Protein Summary

• Protein general information: Q9P2U7  
  • Name: Vesicular glutamate transporter 1 (VGluT1) (Brain specific Na(+) dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 7)
  • Length: 560  
  • Mass: 61613
  • Tissue specificity: Expressed in several regions of the brain including amygdala, cerebellum, cerebral cortex, hippocampus, frontal lobe, medulla, occipital lobe, putamen and temporal lobe. {ECO
• Sequence:

  MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCI
  SFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFA
  IVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLA
  GVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
  SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTN
  VRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGM
  VCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEME
  DEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000221485
• Other Databases: GeneCards:  SLC17A7  Malacards:  SLC17A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060076	excitatory synapse	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005313	L-glutamate transmembrane transporter activity	IBA	molecular function
GO:0098700	neurotransmitter loading into synaptic vesicle	IBA	biological process
GO:0050803	regulation of synapse structure or activity	IBA	biological process
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0030285	integral component of synaptic vesicle membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0006820	anion transport	IBA	biological process
GO:0005326	neurotransmitter transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0005436	sodium:phosphate symporter activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006817	phosphate ion transport	TAS	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0015319	sodium:inorganic phosphate symporter activity	IDA	molecular function
GO:0005313	L-glutamate transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0030672	synaptic vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0060203	clathrin-sculpted glutamate transport vesicle membrane	TAS	cellular component
GO:0014047	glutamate secretion	TAS	biological process
GO:0008068	extracellularly glutamate-gated chloride channel activity	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0042137	sequestering of neurotransmitter	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0051938	L-glutamate import	IEA	biological process
GO:0060076	excitatory synapse	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0005315	inorganic phosphate transmembrane transporter activity	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:1900242	regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0097401	synaptic vesicle lumen acidification	IEA	biological process
GO:0098700	neurotransmitter loading into synaptic vesicle	IEA	biological process
GO:0003407	neural retina development	IEA	biological process
GO:0006817	phosphate ion transport	IEA	biological process
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0043229	intracellular organelle	IEA	cellular component
GO:0098700	neurotransmitter loading into synaptic vesicle	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04723	Retrograde endocannabinoid signaling
hsa04724	Glutamatergic synapse
hsa04721	Synaptic vesicle cycle
hsa05033	Nicotine addiction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray