• Gene id: 57019

Gene Summary

• Gene Symbol: CIAPIN1   Gene   UCSC   Ensembl
• Aliases: Anamorsin, CIAE2, DRE2, PRO0915
• Gene name: cytokine induced apoptosis inhibitor 1
• Alternate names: anamorsin, fe-S cluster assembly protein DRE2 homolog, predicted protein of HQ0915,
• Gene location: 16q21 (57447527: 57428168)     Exons: 9     NC_000016.10
• Gene summary(Entrez): CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [Pu
• OMIM: 608943

Protein Summary

• Protein general information: Q6FI81  
  • Name: Anamorsin (Cytokine induced apoptosis inhibitor 1) (Fe S cluster assembly protein DRE2 homolog)
  • Length: 312  
  • Mass: 33582
  • Tissue specificity: Ubiquitously expressed. Highly expressed in heart, liver and pancreas. {ECO
• Sequence:

  MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLH
  SAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHE
  SDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLK
  KPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGE
  KVLLSDSNLHDA

• Structural information:
  • Interpro: IPR007785  IPR013216  IPR029063  
  • PDB: 2LD4 2YUI 4M7R
  • PDBsum: 2LD4 2YUI 4M7R
  • DIP: 61697
  • STRING: ENSP00000377914
• Other Databases: GeneCards:  CIAPIN1  Malacards:  CIAPIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016226	iron-sulfur cluster assembly	IBA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IDA	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030097	hemopoiesis	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0009055	electron transfer activity	IEA	molecular function
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030097	hemopoiesis	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray