• Gene id: 57007

Gene Summary

• Gene Symbol: ACKR3   Gene   UCSC   Ensembl
• Aliases: CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159, RDC-1, RDC1
• Gene name: atypical chemokine receptor 3
• Alternate names: atypical chemokine receptor 3, C-X-C chemokine receptor type 7, G protein-coupled receptor, G-protein coupled receptor 159, G-protein coupled receptor RDC1 homolog, chemokine (C-X-C motif) receptor 7, chemokine orphan receptor 1,
• Gene location: 2q37.3 (236537130: 236582357)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not b
• OMIM: 610376

Protein Summary

• Protein general information: P25106  
  • Name: Atypical chemokine receptor 3 (C X C chemokine receptor type 7) (CXC R7) (CXCR 7) (Chemokine orphan receptor 1) (G protein coupled receptor 159) (G protein coupled receptor RDC1 homolog) (RDC 1)
  • Length: 362  
  • Mass: 41493
  • Tissue specificity: Expressed in monocytes, basophils, B-cells, umbilical vein endothelial cells (HUVEC) and B-lymphoblastoid cells. Lower expression detected in CD4+ T-lymphocytes and natural killer cells. In the brain, detected in endothelial cells and
• Sequence:

  MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTT
  GYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT
  NTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPF
  SIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
  QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

• Structural information:
  • Interpro: IPR001416  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000272928
• Other Databases: GeneCards:  ACKR3  Malacards:  ACKR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0031623	receptor internalization	IMP	biological process
GO:0031623	receptor internalization	IMP	biological process
GO:0019958	C-X-C chemokine binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005044	scavenger receptor activity	IMP	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019956	chemokine binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1905322	positive regulation of mesenchymal stem cell migration	IEA	biological process
GO:0016494	C-X-C chemokine receptor activity	IMP	molecular function
GO:0070098	chemokine-mediated signaling pathway	IMP	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq