• Gene id: 56998

Gene Summary

• Gene Symbol: CTNNBIP1   Gene   UCSC   Ensembl
• Aliases: ICAT
• Gene name: catenin beta interacting protein 1
• Alternate names: beta-catenin-interacting protein 1, beta-catenin-interacting protein ICAT, inhibitor of beta-catenin and Tcf-4,
• Gene location: 1p36.22 (9910321: 9848275)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for t
• OMIM: 607758

Protein Summary

• Protein general information: Q9NSA3  
  • Name: Beta catenin interacting protein 1 (Inhibitor of beta catenin and Tcf 4)
  • Length: 81  
  • Mass: 9170
• Sequence:

  MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSE
  TEDRRQ

• Structural information:
  • Interpro: IPR042999  IPR009428  IPR036911  
  • PDB: 1LUJ 1M1E 1T08
  • PDBsum: 1LUJ 1M1E 1T08
  • STRING: ENSP00000366474
• Other Databases: GeneCards:  CTNNBIP1  Malacards:  CTNNBIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008013	beta-catenin binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0030877	beta-catenin destruction complex	IBA	cellular component
GO:0030178	negative regulation of Wnt signaling pathway	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0060633	negative regulation of transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0070016	armadillo repeat domain binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0002528	regulation of vascular permeability involved in acute inflammatory response	IMP	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045657	positive regulation of monocyte differentiation	IMP	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0072201	negative regulation of mesenchymal cell proliferation	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq