• Gene id: 56993

Gene Summary

• Gene Symbol: TOMM22   Gene   UCSC   Ensembl
• Aliases: 1C9-2, MST065, MSTP065, TOM22
• Gene name: translocase of outer mitochondrial membrane 22
• Alternate names: mitochondrial import receptor subunit TOM22 homolog, mitochondrial import receptor Tom22, translocase of outer membrane 22 kDa subunit homolog, translocase of outer mitochondrial membrane 22 homolog,
• Gene location: 22q13.1 (38681956: 38685420)     Exons: 4     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondr
• OMIM: 607046

Protein Summary

• Protein general information: Q9NS69  
  • Name: Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9 2) (Translocase of outer membrane 22 kDa subunit homolog)
  • Length: 142  
  • Mass: 15522
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQ
  KMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

• Structural information:
  • Interpro: IPR005683  
  • STRING: ENSP00000216034
• Other Databases: GeneCards:  TOMM22  Malacards:  TOMM22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0051204	protein insertion into mitochondrial membrane	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0008320	protein transmembrane transporter activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006626	protein targeting to mitochondrion	IEA	biological process
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0008320	protein transmembrane transporter activity	ISS	molecular function
GO:0008320	protein transmembrane transporter activity	TAS	molecular function
GO:0005742	mitochondrial outer membrane translocase complex	IDA	cellular component
GO:0005742	mitochondrial outer membrane translocase complex	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0045040	protein insertion into mitochondrial outer membrane	IDA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0071806	protein transmembrane transport	IEA	biological process
GO:0071806	protein transmembrane transport	IEA	biological process
GO:0071806	protein transmembrane transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)