• Gene id: 56984

Gene Summary

• Gene Symbol: PSMG2   Gene   UCSC   Ensembl
• Aliases: CLAST3, HCCA3, HsT1707, MDS003, PAC2, TNFSF5IP1
• Gene name: proteasome assembly chaperone 2
• Alternate names: proteasome assembly chaperone 2, CD40 ligand-activated specific transcript 3, HDCMC29P, HSPC260, PAC-2, hepatocellular carcinoma susceptibility protein, hepatocellular carcinoma-susceptibility protein 3, likely ortholog of mouse CD40 ligand-activated specific tr,
• Gene location: 18p11.21 (12658738: 12725739)     Exons: 8     NC_000018.10
• OMIM: 607054

Protein Summary

• Protein general information: Q969U7  
  • Name: Proteasome assembly chaperone 2 (PAC 2) (Hepatocellular carcinoma susceptibility protein 3) (Tumor necrosis factor superfamily member 5 induced protein 1)
  • Length: 264  
  • Mass: 29396
  • Tissue specificity: Widely expressed with highest levels in lung, brain and colon. Moderately expressed in muscle, stomach, spleen and heart. Weakly expressed in small intestine, pancreas and liver. Highly expressed in hepatocellular carcinomas with low l
• Sequence:

  MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINA
  EVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKS
  VQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLN
  EWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF

• Structural information:
  • Interpro: IPR019151  IPR016562  IPR038389  
  • STRING: ENSP00000325919
• Other Databases: GeneCards:  PSMG2  Malacards:  PSMG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0043248	proteasome assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0007094	mitotic spindle assembly checkpoint	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0101031	chaperone complex	IDA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060090	molecular adaptor activity	IGI	molecular function
GO:0051131	chaperone-mediated protein complex assembly	IGI	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray