• Gene id: 56965

Gene Summary

• Gene Symbol: PARP6   Gene   UCSC   Ensembl
• Aliases: ARTD17, PARP-6-B1, PARP-6-C, pART17
• Gene name: poly(ADP-ribose) polymerase family member 6
• Alternate names: protein mono-ADP-ribosyltransferase PARP6, ADP-ribosyltransferase diphtheria toxin-like 17, PARP-6, poly [ADP-ribose] polymerase 6,
• Gene location: 15q23 (72272553: 72241180)     Exons: 25     NC_000015.10
• OMIM: 0

Protein Summary

• Protein general information: Q2NL67  
  • Name: Protein mono ADP ribosyltransferase PARP6 (EC 2.4.2. ) (ADP ribosyltransferase diphtheria toxin like 17) (ARTD17) (Poly [ADP ribose] polymerase 6) (PARP 6)
  • Length: 630  
  • Mass: 71115
• Sequence:

  MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDIDLHINI
  SFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQQWKHLSNDFL
  KTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVF
  GYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSM
  LKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSVVDPTDPKTLAFNPK
  KKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWIISSNRSHIVKLPLSRLKFMHTSHQFLLLS
  SPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKG
  QHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYED
  GQVGDANINTQDPKIQKEIMRVIGTQVYTN

• Structural information:
  • Protein Domains: (394..62-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR012317  
  • Prosite: PS51059
  • STRING: ENSP00000456348
• Other Databases: GeneCards:  PARP6  Malacards:  PARP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071782	endoplasmic reticulum tubular network	IBA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0006471	protein ADP-ribosylation	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0019900	kinase binding	IBA	molecular function
GO:0005635	nuclear envelope	IBA	cellular component
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881