• Gene id: 5696

Gene Summary

• Gene Symbol: PSMB8   Gene   UCSC   Ensembl
• Aliases: ALDD, D6S216, D6S216E, JMP, LMP7, NKJO, PRAAS1, PSMB5i, RING10
• Gene name: proteasome 20S subunit beta 8
• Alternate names: proteasome subunit beta type-8, low molecular mass protein 7, low molecular weight protein 7, macropain subunit C13, multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunc,
• Gene location: 6p21.32 (32844678: 32840716)     Exons: 7     NC_000006.12
• Gene summary(Entrez): The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
• OMIM: 177046

Protein Summary

• Protein general information: P28062  
  • Name: Proteasome subunit beta type 8 (EC 3.4.25.1) (Low molecular mass protein 7) (Macropain subunit C13) (Multicatalytic endopeptidase complex subunit C13) (Proteasome component C13) (Proteasome subunit beta 5i) (Really interesting new gene 10 protein)
  • Length: 276  
  • Mass: 30354
• Sequence:

  MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMAHGTTT
  LAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSA
  ASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAY
  DLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

• Structural information:
  • Interpro: IPR029055  IPR000243  IPR035705  IPR016050  IPR001353   IPR023333  
  • Prosite: PS00854 PS51476
  • PDB: 5L5A 5L5B 5L5D 5L5E 5L5F 5L5H 5L5I 5L5J 5L5O 5L5P 5L5Q 5L5R 5L5S 5L5T 5L5U 5L5V 5LTT 5M2B 6AVO 6E5B
  • PDBsum: 5L5A 5L5B 5L5D 5L5E 5L5F 5L5H 5L5I 5L5J 5L5O 5L5P 5L5Q 5L5R 5L5S 5L5T 5L5U 5L5V 5LTT 5M2B 6AVO 6E5B
  • STRING: ENSP00000364016
• Other Databases: GeneCards:  PSMB8  Malacards:  PSMB8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010498	proteasomal protein catabolic process	IBA	biological process
GO:0010499	proteasomal ubiquitin-independent protein catabolic process	IBA	biological process
GO:0004175	endopeptidase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005839	proteasome core complex	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000502	proteasome complex	IDA	cellular component
GO:0019774	proteasome core complex, beta-subunit complex	ISS	cellular component
GO:0045444	fat cell differentiation	IMP	biological process
GO:1990111	spermatoproteasome complex	ISS	cellular component
GO:0005839	proteasome core complex	ISS	cellular component
GO:0052548	regulation of endopeptidase activity	IMP	biological process
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0051603	proteolysis involved in cellular protein catabolic process	IEA	biological process
GO:0000502	proteasome complex	IEA	cellular component
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0005839	proteasome core complex	IEA	cellular component
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0000502	proteasome complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000502	proteasome complex	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045444	fat cell differentiation	IEA	biological process
GO:0019882	antigen processing and presentation	IEA	biological process
GO:1990111	spermatoproteasome complex	IEA	cellular component
GO:0005839	proteasome core complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03050	Proteasome

Diseases

Associated diseases	References
Autoinflammation lipodystrophy and dermatosis syndrome	KEGG:H01741
Autoinflammation lipodystrophy and dermatosis syndrome	KEGG:H01741
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881