• Gene id: 56957

Gene Summary

• Gene Symbol: OTUD7B   Gene   UCSC   Ensembl
• Aliases: CEZANNE, ZA20D1
• Gene name: OTU deubiquitinase 7B
• Alternate names: OTU domain-containing protein 7B, OTU domain containing 7B, cellular zinc finger anti-NF-kappa-B protein, cellular zinc finger anti-NF-kappaB Cezanne, zinc finger A20 domain-containing protein 1, zinc finger protein Cezanne, zinc finger, A20 domain containing 1,
• Gene location: 1q21.2 (150010775: 149937811)     Exons: 14     NC_000001.11
• OMIM: 146734

Protein Summary

• Protein general information: Q6GQQ9  
  • Name: OTU domain containing protein 7B (EC 3.4.19.12) (Cellular zinc finger anti NF kappa B protein) (Cezanne) (Zinc finger A20 domain containing protein 1) (Zinc finger protein Cezanne)
  • Length: 843  
  • Mass: 92526
  • Tissue specificity: Widely expressed. Abundant in kidney, heart and fetal liver. Expressed differentially among B-cells at distinct developmental stages. Higher expression seen in primary immature B-cells as compared to the mature cells. {ECO
• Sequence:

  MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGSGGSRTPEKGFSDREP
  TRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDLTVYNEDFRSF
  IERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGV
  EKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVF
  VLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFSALVSMEQKENTKEQA
  VIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEVKLHLLHSYMNVKWIPLSSDAQAPLAQPESP
  TASAGDEPRSTPESGDSDKESVGSSSTSNEGGRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLM
  HSKGSKPGGVGTGLGGSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILR
  TAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQ
  PTGPPAESRAMAFSTGYPGDFTIPRPSGGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLE
  PGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYRE
  ELRRREREPDGELLVHRF

• Structural information:
  • Protein Domains: (183..36-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139"-)
  • Interpro: IPR003323  IPR002653  
  • Prosite: PS50802 PS51036
  • PDB: 5LRU 5LRV 5LRW
  • PDBsum: 5LRU 5LRV 5LRW
  • DIP: 33805
  • STRING: ENSP00000462729
• Other Databases: GeneCards:  OTUD7B  Malacards:  OTUD7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990380	Lys48-specific deubiquitinase activity	IDA	molecular function
GO:1900181	negative regulation of protein localization to nucleus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071108	protein K48-linked deubiquitination	IDA	biological process
GO:0032717	negative regulation of interleukin-8 production	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0035871	protein K11-linked deubiquitination	IBA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0070536	protein K63-linked deubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0071108	protein K48-linked deubiquitination	IBA	biological process
GO:0071947	protein deubiquitination involved in ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0070536	protein K63-linked deubiquitination	IDA	biological process
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0002385	mucosal immune response	ISS	biological process
GO:0071108	protein K48-linked deubiquitination	ISS	biological process
GO:0008234	cysteine-type peptidase activity	ISS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	ISS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:1990380	Lys48-specific deubiquitinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0002385	mucosal immune response	IEA	biological process
GO:0071108	protein K48-linked deubiquitination	IEA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq