• Gene id: 56943

Gene Summary

• Gene Symbol: ENY2   Gene   UCSC   Ensembl
• Aliases: DC6, Sus1, e(y)2
• Gene name: ENY2 transcription and export complex 2 subunit
• Alternate names: transcription and mRNA export factor ENY2, enhancer of yellow 2 homolog, enhancer of yellow 2 transcription factor homolog,
• Gene location: 8q23.1 (114464275: 114813701)     Exons: 21     NC_000011.10

Protein Summary

• Protein general information: Q9NPA8  
  • Name: Transcription and mRNA export factor ENY2 (Enhancer of yellow 2 transcription factor homolog)
  • Length: 101  
  • Mass: 11529
• Sequence:

  MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKG
  RALVPDSVKKELLQRIRTFLAQHASL

• Structural information:
  • Interpro: IPR018783  IPR038212  
  • PDB: 4DHX
  • PDBsum: 4DHX
  • STRING: ENSP00000429986
• Other Databases: GeneCards:  ENY2  Malacards:  ENY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000124	SAGA complex	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0016578	histone deubiquitination	IBA	biological process
GO:0016973	poly(A)+ mRNA export from nucleus	IBA	biological process
GO:0071819	DUBm complex	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0070390	transcription export complex 2	IDA	cellular component
GO:0000124	SAGA complex	IDA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000124	SAGA complex	IDA	cellular component
GO:0016973	poly(A)+ mRNA export from nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0000124	SAGA complex	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061179	negative regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0016578	histone deubiquitination	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0071819	DUBm complex	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000124	SAGA complex	IEA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IEA	biological process
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0070390	transcription export complex 2	IEA	cellular component
GO:0016578	histone deubiquitination	IDA	biological process
GO:0000124	SAGA complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071819	DUBm complex	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)