• Gene id: 56940

Gene Summary

• Gene Symbol: DUSP22   Gene   UCSC   Ensembl
• Aliases: JKAP, JSP-1, JSP1, LMW-DSP2, LMWDSP2, MKP-x, MKPX, VHX
• Gene name: dual specificity phosphatase 22
• Alternate names: dual specificity protein phosphatase 22, JNK-stimulating phosphatase 1, JNK-stimulatory phosphatase-1, MAP kinase phosphatase x, epididymis secretory sperm binding protein, homolog of mouse dual specificity phosphatase LMW-DSP2, low molecular weight dual specif,
• Gene location: 6p25.3 (292056: 351354)     Exons: 9     NC_000006.12
• OMIM: 616778

Protein Summary

• Protein general information: Q9NRW4  
  • Name: Dual specificity protein phosphatase 22 (EC 3.1.3.16) (EC 3.1.3.48) (JNK stimulatory phosphatase 1) (JSP 1) (Low molecular weight dual specificity phosphatase 2) (LMW DSP2) (Mitogen activated protein kinase phosphatase x) (MAP kinase phosphatase x) (MKP x
  • Length: 184  
  • Mass: 20910
  • Tissue specificity: Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. {ECO
• Sequence:

  MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIH
  ECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWL
  KEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

• Structural information:
  • Protein Domains: (65..13-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR000340  IPR029021  IPR000387  IPR020422  
  • Prosite: PS50056 PS50054
  • PDB: 1WRM 4WOH
  • PDBsum: 1WRM 4WOH
  • STRING: ENSP00000397459
• Other Databases: GeneCards:  DUSP22  Malacards:  DUSP22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IDA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031941	filamentous actin	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0051895	negative regulation of focal adhesion assembly	IDA	biological process
GO:0061851	leading edge of lamellipodium	IDA	cellular component
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:1903996	negative regulation of non-membrane spanning protein tyrosine kinase activity	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:1990782	protein tyrosine kinase binding	IEA	molecular function
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0002710	negative regulation of T cell mediated immunity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Peripheral T cell lymphoma	KEGG:H01892
Anaplastic large-cell lymphoma	KEGG:H01601
Peripheral T cell lymphoma	KEGG:H01892
Anaplastic large-cell lymphoma	KEGG:H01601
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq