• Gene id: 56937

Gene Summary

• Gene Symbol: PMEPA1   Gene   UCSC   Ensembl
• Aliases: STAG1, TMEPAI
• Gene name: prostate transmembrane protein, androgen induced 1
• Alternate names: protein TMEPAI, solid tumor-associated 1 protein, transmembrane, prostate androgen induced RNA,
• Gene location: 20q13.31 (57711535: 57648391)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth f
• OMIM: 606564

Protein Summary

• Protein general information: Q969W9  
  • Name: Protein TMEPAI (Prostate transmembrane protein androgen induced 1) (Solid tumor associated 1 protein) (Transmembrane prostate androgen induced protein)
  • Length: 287  
  • Mass: 31609
  • Tissue specificity: Highest expression in prostate. Also expressed in ovary.
• Sequence:

  MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELEFVQIIIIVVVMMVMVVVITCLLSHYKLSARSFISR
  HSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYLQHEIDLPPTI
  SLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRM
  EGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL

• Structural information:
  • Interpro: IPR039122  
  • STRING: ENSP00000345826
• Other Databases: GeneCards:  PMEPA1  Malacards:  PMEPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060394	negative regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0031901	early endosome membrane	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0070412	R-SMAD binding	IBA	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0010991	negative regulation of SMAD protein complex assembly	IBA	biological process
GO:0060394	negative regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0010991	negative regulation of SMAD protein complex assembly	IDA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0010008	endosome membrane	IDA	cellular component
GO:0060394	negative regulation of pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0010991	negative regulation of SMAD protein complex assembly	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0070412	R-SMAD binding	IEA	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0050699	WW domain binding	IPI	molecular function

Diseases

Associated diseases	References
Prostate cancer	PMID:12907594
Breast cancer	PMID:14639658
Rectal neoplasm	PMID:11568975
Gastric adenocarcinoma	PMID:11568975
renal cell carcinoma	PMID:11568975
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq