• Gene id: 56923

Gene Summary

• Gene Symbol: NMUR2   Gene   UCSC   Ensembl
• Aliases: FM-4, FM4, NMU-R2, NMU2R, TGR-1, TGR1
• Gene name: neuromedin U receptor 2
• Alternate names: neuromedin-U receptor 2, G-protein coupled receptor FM-4, G-protein coupled receptor TGR-1, growth hormone secretagogue receptor family, member 4,
• Gene location: 5q33.1 (152405278: 152391545)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the r
• OMIM: 602306

Protein Summary

• Protein general information: Q9GZQ4  
  • Name: Neuromedin U receptor 2 (NMU R2) (G protein coupled receptor FM 4) (G protein coupled receptor TGR 1)
  • Length: 415  
  • Mass: 47696
  • Tissue specificity: Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the g
• Sequence:

  MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGVIGNVLVCLVILQHQA
  MKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTVSVERYVAILH
  PFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFY
  LLPMTVISVLYYLMALRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES
  LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELT
  EDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005390  IPR005392  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000255262
• Other Databases: GeneCards:  NMUR2  Malacards:  NMUR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001607	neuromedin U receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007631	feeding behavior	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0002023	reduction of food intake in response to dietary excess	IEA	biological process
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0048265	response to pain	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0050482	arachidonic acid secretion	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005229	intracellular calcium activated chloride channel activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0043006	activation of phospholipase A2 activity by calcium-mediated signaling	IDA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0048016	inositol phosphate-mediated signaling	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0007417	central nervous system development	IEP	biological process
GO:0006940	regulation of smooth muscle contraction	NAS	biological process
GO:0019722	calcium-mediated signaling	NAS	biological process
GO:0001607	neuromedin U receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007631	feeding behavior	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0002023	reduction of food intake in response to dietary excess	IEA	biological process
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0048265	response to pain	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0050482	arachidonic acid secretion	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005229	intracellular calcium activated chloride channel activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0043006	activation of phospholipase A2 activity by calcium-mediated signaling	IDA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0048016	inositol phosphate-mediated signaling	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0007417	central nervous system development	IEP	biological process
GO:0006940	regulation of smooth muscle contraction	NAS	biological process
GO:0019722	calcium-mediated signaling	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881