Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 56915
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol EXOSC5   Gene   UCSC   Ensembl
Aliases RRP41B, RRP46, Rrp46p, hRrp46p, p12B
Gene name exosome component 5
Alternate names exosome complex component RRP46, chronic myelogenous leukemia tumor antigen 28, exosome complex exonuclease RRP46, exosome component Rrp46, ribosomal RNA-processing protein 46,
Gene location 19q13.2 (172188223: 172042073)     Exons: 21     NC_000005.10
OMIM 606492

Protein Summary
Protein general information Q9NQT4  

Name: Exosome complex component RRP46 (Chronic myelogenous leukemia tumor antigen 28) (Exosome component 5) (Ribosomal RNA processing protein 46) (p12B)

Length: 235  Mass: 25249

Tissue specificity: Highly expressed in a variety of hematopoietic and epithelial tumor cell lines, but not in normal hematopoietic tissues or other normal tissue, with the exception of testis.

Sequence MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKAT
LEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRA
LFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYR
ESLQRRYSKS
Structural information
Interpro:  IPR001247  IPR015847  IPR036345  IPR027408  IPR020568  

PDB:  		 2NN6 6D6Q 6D6R 6H25
PDBsum:   2NN6 6D6Q 6D6R 6H25

DIP:  
29846
MINT:  
STRING:   ENSP00000221233
Other Databases GeneCards:  EXOSC5  Malacards:  EXOSC5

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0034475 U4 snRNA 3'-end processin
g
 IBA biological process
GO:0005730 nucleolus
 IBA cellular component
GO:0000177 cytoplasmic exosome (RNas
e complex)
 IBA cellular component
GO:0000176 nuclear exosome (RNase co
mplex)
 IBA cellular component
GO:0071051 polyadenylation-dependent
snoRNA 3'-end processing
 IBA biological process
GO:0071028 nuclear mRNA surveillance
 IBA biological process
GO:0034427 nuclear-transcribed mRNA
catabolic process, exonuc
leolytic, 3'-5'
 IBA biological process
GO:0016075 rRNA catabolic process
 IBA biological process
GO:0004532 exoribonuclease activity
 IDA NOT|molecular function
GO:0045006 DNA deamination
 IDA biological process
GO:0035327 transcriptionally active
chromatin
 IMP cellular component
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0000178 exosome (RNase complex)
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0003723 RNA binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0006364 rRNA processing
 IEA biological process
GO:0051607 defense response to virus
 IMP biological process
GO:0006364 rRNA processing
 TAS biological process
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006401 RNA catabolic process
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005730 nucleolus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0090503 RNA phosphodiester bond h
ydrolysis, exonucleolytic
 IEA biological process
GO:0090503 RNA phosphodiester bond h
ydrolysis, exonucleolytic
 IEA biological process
GO:0000178 exosome (RNase complex)
 IDA cellular component
GO:0005737 cytoplasm
 NAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0000175 3'-5'-exoribonuclease act
ivity
 NAS molecular function
GO:0005730 nucleolus
 NAS cellular component
GO:0006364 rRNA processing
 NAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03018RNA degradation

Diseases

Expand All | Collapse All
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract