About Us

Search Result


Gene id 56911
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MAP3K7CL   Gene   UCSC   Ensembl
Aliases C21orf7, HC21ORF7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4
Gene name MAP3K7 C-terminal like
Alternate names MAP3K7 C-terminal-like protein, TAK1-like protein 1, TAK1-like protein 2, TAK1-like protein 4, TGF-beta activated kinase,
Gene location 21q21.3 (29077113: 29175888)     Exons: 18     NC_000021.9
OMIM 603320

Protein Summary

Protein general information P57077  

Name: MAP3K7 C terminal like protein (TAK1 like protein)

Length: 242  Mass: 27248

Tissue specificity: Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and

Sequence MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDY
SISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCH
DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCV
EQLEKLRIQYQKRQGSS
Structural information
Interpro:  IPR042800  
STRING:   ENSP00000382828
Other Databases GeneCards:  MAP3K7CL  Malacards:  MAP3K7CL

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0005829 cytosol
HDA cellular component
GO:0005634 nucleus
HDA cellular component
Associated diseases References
Hypospermatogenesis MIK: 28361989

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract